KEGG   Thermococcus sp. AM4: TAM4_151Help
Entry
TAM4_151          CDS       T01638                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tha  Thermococcus sp. AM4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TAM4_151
   00052 Galactose metabolism
    TAM4_151
   00500 Starch and sucrose metabolism
    TAM4_151
   00520 Amino sugar and nucleotide sugar metabolism
    TAM4_151
Enzymes [BR:tha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TAM4_151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1448163..1449041
Genome map
AA seq 292 aa AA seqDB search
MRVKKAVIPAAGLGTRMLPITKSMPKEMLPIVDKPVIHYVVEEAIKAGIDDILIVTGKGK
RAIEDYFDRSFELEFYLREKGKFEELKQIEEIGEMVDIYYVRQKKPLGLGDAILHAEKHV
NGEPFAVLLGDDIIVSEEPGIKQLIEIAERREAPVVGVERVPWELVSRYGIVDGKPLGDG
LYQVRHLVEKPSPKEAPSNVAIIGRYVLTPEVFDALRETPPGRGGELQLTDALQRILSSQ
NIFAKEIKGERYDVGSKLGFVIANIELSLKRGELREELLTFLKNLLREVSDE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgagggttaagaaggcagtaataccagcggcaggtctcggcacgagaatgctacccata
accaagtcgatgcccaaggaaatgctcccgatagttgacaagccggtcatccactacgtt
gttgaagaggcaatcaaagccggaatcgacgacattctcatagtaaccggaaagggaaag
cgcgctatagaggattacttcgataggagcttcgagctggagttctatctaagggaaaag
ggaaagttcgaggagctgaagcagatagaggaaatcggcgagatggttgacatctactac
gtccgtcagaagaagcccctcggtcttggagatgcaatactccacgcggaaaagcacgtg
aacggggaaccctttgcagtcctccttggcgacgacatcatagtaagcgaagagcccgga
ataaaacagctcatcgagatagccgagcggagagaagctccagtggtgggagtggagcgc
gttccctgggaacttgtaagccgatacggaatcgtggacgggaaaccacttggggatgga
ctctatcaggtgagacacctcgtggaaaagccctcccccaaagaggcccccagcaacgtt
gcaataatcgggaggtacgtcctgacgcctgaggtatttgacgccctgagagaaactcct
ccggggagaggtggcgagttacagctcacagatgccctccagagaattctatctagccag
aacatcttcgctaaggagataaaaggcgagagatatgacgttggaagtaagcttggattc
gttatagcgaacattgaactgagcctaaagagaggggaactgagagaggagttgctaacc
ttcctcaaaaatctcctaagggaggtctcagatgagtag

DBGET integrated database retrieval system