KEGG   Thermococcus sp. AM4: TAM4_1536Help
Entry
TAM4_1536         CDS       T01638                                 

Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tha  Thermococcus sp. AM4
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TAM4_1536
Enzymes [BR:tha01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TAM4_1536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(916300..917112)
Genome map
AA seq 270 aa AA seqDB search
MKFAGVNLDEPRVMGVINVSPESFYKGSVRNDEKALAETAVRMVEEGASFIDIGAKSTAP
YLETQIPLEEEIRRAVWAVKVVKDAVDVPLSIDTTSARVAEEALKAGADIINDVTGFKGD
PGMAKVASKYSAPAVLCAHGNVRDFSDPVRTVIEFLEESLTIAEEHGVEDVAVDPAIGFL
RPEWPPWYEWDSKVIANLNLLKLLGRPILVGISRKSFIGAITGREKPEERLAGSLSATAI
AVLKGARIVRTHDVKETLDAIKVARHIARY
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgcgggagttaatcttgacgagccgagggtaatgggagtcatcaacgtctcg
cccgagagcttctacaaggggagcgttaggaacgatgaaaaggctttggccgagaccgcc
gttagaatggtcgaggagggcgcgagtttcatagacatcggcgcaaaatcaacggcccct
tacctcgagactcagattccgctcgaggaggaaatcagaagggcagtttgggccgtcaag
gtcgtcaaggacgcggttgatgttcccctgagcatagacaccacgagcgcgagggttgcc
gaggaagctttaaaggctggcgccgacatcataaacgacgtcacaggcttcaagggcgac
ccggggatggctaaggttgcctctaagtacagtgctccggccgtcctctgcgcccacgga
aatgttagggacttctcggacccggttagaaccgtcattgagttccttgaggagagcctg
acgatagcggaggagcacggggttgaagatgttgccgttgatccggccatcggctttctc
cgcccggagtggccgccgtggtacgagtgggactcgaaggtaatagcgaacctcaacctg
ctcaagctcctcggaaggccaatcctcgtcggcatctcgcggaagtccttcataggcgcg
ataacgggcagagagaaaccggaggagaggctcgccggcagtctgtcggcaacggcaata
gcggttctgaagggtgcgagaatagtgagaacccacgacgtgaaggaaacccttgacgcg
attaaggttgcccggcatatagcccgttattag

DBGET integrated database retrieval system