KEGG   Thermococcus sp. AM4: TAM4_1537Help
Entry
TAM4_1537         CDS       T01638                                 

Definition
(GenBank) NAD(P)-dependent glyceraldehyde 3-phosphate dehydrogenase archaeal
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
tha  Thermococcus sp. AM4
Pathway
tha00010  Glycolysis / Gluconeogenesis
tha01100  Metabolic pathways
tha01110  Biosynthesis of secondary metabolites
tha01120  Microbial metabolism in diverse environments
tha01130  Biosynthesis of antibiotics
tha01200  Carbon metabolism
tha01230  Biosynthesis of amino acids
Module
tha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tha_M00002  Glycolysis, core module involving three-carbon compounds
tha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TAM4_1537
Enzymes [BR:tha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     TAM4_1537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C GFO_IDH_MocA NAD_binding_3 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: EEB74170
UniProt: B7R1W5
Position
complement(936746..937753)
Genome map
AA seq 335 aa AA seqDB search
MARVKVGINGYGTIGKRVAYAVTKQDDMKLIGVTKTKPDFEAYRAKELGIPVYAASEEFL
PRFEKAGFEVSGTLEDLLGEVDVIVDATPGGMGAKNKAIYEKAGVKAVFQGGEKANVAEV
SFVAQANYEKALGKDYVRVVSCNTTGLTRTLSAIQEYIDYVYAVMIRRAADPNDTKRGPI
NAITPSVTVPSHHGPDVQTVIPINIETSAFVVPTTLMHVHSVMVELKKPVEAKDVIDIFE
NTTRVLLFEKEKGFESTAQLIEFARDLHREWNNLYEIAVWKESINVRGNRLFYIQAVHQE
SDVVPENIDAIRAMFELADKWESIKKTNKSLGILK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggccagggtcaaggtcggaataaacggctacggcacgataggtaagagggtagcttac
gccgtaaccaaacaggacgatatgaagctcatcggcgtaaccaagaccaagccggacttc
gaggcataccgcgcgaaagagctcggaatcccggtctatgcagcgagcgaggagttcctc
ccgcgctttgagaaggcaggcttcgaggtttccggaacgctggaggatcttctcggcgag
gttgacgtaatcgttgacgccacccctgggggaatgggggcaaagaacaaggcaatttac
gagaaggccggagttaaggccgtattccagggcggtgagaaggcgaacgttgccgaggtt
tccttcgtggcccaggccaactacgagaaggccttgggaaaggactacgtccgcgtcgtc
tcctgcaacacaacgggtttaaccagaaccctctcggccattcaggagtacatagactac
gtttacgcggtcatgattagaagggctgccgaccccaacgacacgaagcgcggtccaata
aacgccataacgccgagcgttacggtgccttcgcaccacgggccggacgtccagacggtt
ataccgattaacatcgagacgagcgccttcgtcgtcccgactactctcatgcacgttcac
agcgtgatggttgagctgaagaagccggtcgaggcgaaggacgtcatcgatatctttgag
aacaccacgcgcgttctgctcttcgagaaggagaagggattcgagagcacagcccagctc
atagagtttgcaagggacctgcaccgcgagtggaacaacctctacgagatagccgtctgg
aaggagagcataaacgtgcgtggaaacaggctgttctacattcaggccgtccaccaggag
agcgacgtggttccggagaatatcgacgcgataagggccatgtttgagctcgcagacaag
tgggagagcataaagaagacgaacaaaagcttggggattttgaagtga

DBGET integrated database retrieval system