KEGG   Thermococcus sp. AM4: TAM4_156Help
Entry
TAM4_156          CDS       T01638                                 

Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tha  Thermococcus sp. AM4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TAM4_156
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TAM4_156
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TAM4_156
Enzymes [BR:tha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TAM4_156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1375671..1376606
Genome map
AA seq 311 aa AA seqDB search
MKSRLGEGFGVRLYLKNETVNPTWSFKDRGTFLAMSYALKAGYKTVGTVSTGNMAASVSA
YASRFGLKAKILVSESASDEKLKAVSVYGEEVIRVLGDYGRLYFESLKLGEKLGVYFMNS
DNPFRTEGYKGIAFEIAEELTPDYVLIPTSSGGLFRGVAKGFLELYENGLIDGLPKLIAV
QAEGCSPICKAFREGKEKVERFENPKTIAKAIANPYPPSGNAVLKLLREFGWGCVSVSDD
EIRKAQKRLAREGLFVQPASATGIAALEKLSLPEGAKVVSILTGSGLRTLKDAPAGKITE
CPLEGLENCLR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcgaggctcggcgaggggttcggcgttaggctctacctcaagaacgaaacggtg
aacccgacctggagcttcaaggacagagggacgttcctcgcgatgagctacgcactcaaa
gccggctacaaaaccgttgggacggtctcaaccggcaacatggcggcgagcgtctctgcc
tacgcttcacgcttcggattgaaagctaaaattctcgtctccgagagcgcaagcgacgag
aaattaaaggccgtctcggtctacggcgaggaagtgataagggtcctcggggactacggg
aggctctacttcgagagcctcaagcttggggaaaagctcggggtctactttatgaactcc
gacaaccccttcagaaccgagggctacaaaggtatcgcgtttgagatagcggaggagctt
accccggactacgttttgattccgacgagttcaggcggccttttcagaggagtggcaaag
ggcttcctcgagctttacgagaatgggcttattgatggccttccaaagctgatagcggtt
caggctgaaggttgctccccgatatgtaaagccttccgtgaagggaaggaaaaggtggag
cgcttcgagaacccgaaaacgatagcgaaggcaatagcgaacccctacccgccgagcggg
aacgccgttctgaaacttctgagggagtttggctggggttgcgtttcagtttcggacgat
gaaatcagaaaagctcagaaaaggctcgcccgcgagggcctcttcgtccagccggcgagc
gcgacggggatagcggccttagagaagctcagccttcccgaaggagccaaggtcgtctcg
attctcaccggttctggattgagaaccctgaaagatgccccggcggggaagataacggag
tgcccgctcgaggggcttgaaaactgtctgaggtga

DBGET integrated database retrieval system