KEGG   Thermococcus sp. AM4: TAM4_156Help
Entry
TAM4_156          CDS       T01638                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tha  Thermococcus sp. AM4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TAM4_156
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TAM4_156
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TAM4_156
Enzymes [BR:tha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TAM4_156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1375671..1376606
Genome map
AA seq 311 aa AA seqDB search
MKSRLGEGFGVRLYLKNETVNPTWSFKDRGTFLAMSYALKAGYKTVGTVSTGNMAASVSA
YASRFGLKAKILVSESASDEKLKAVSVYGEEVIRVLGDYGRLYFESLKLGEKLGVYFMNS
DNPFRTEGYKGIAFEIAEELTPDYVLIPTSSGGLFRGVAKGFLELYENGLIDGLPKLIAV
QAEGCSPICKAFREGKEKVERFENPKTIAKAIANPYPPSGNAVLKLLREFGWGCVSVSDD
EIRKAQKRLAREGLFVQPASATGIAALEKLSLPEGAKVVSILTGSGLRTLKDAPAGKITE
CPLEGLENCLR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcgaggctcggcgaggggttcggcgttaggctctacctcaagaacgaaacggtg
aacccgacctggagcttcaaggacagagggacgttcctcgcgatgagctacgcactcaaa
gccggctacaaaaccgttgggacggtctcaaccggcaacatggcggcgagcgtctctgcc
tacgcttcacgcttcggattgaaagctaaaattctcgtctccgagagcgcaagcgacgag
aaattaaaggccgtctcggtctacggcgaggaagtgataagggtcctcggggactacggg
aggctctacttcgagagcctcaagcttggggaaaagctcggggtctactttatgaactcc
gacaaccccttcagaaccgagggctacaaaggtatcgcgtttgagatagcggaggagctt
accccggactacgttttgattccgacgagttcaggcggccttttcagaggagtggcaaag
ggcttcctcgagctttacgagaatgggcttattgatggccttccaaagctgatagcggtt
caggctgaaggttgctccccgatatgtaaagccttccgtgaagggaaggaaaaggtggag
cgcttcgagaacccgaaaacgatagcgaaggcaatagcgaacccctacccgccgagcggg
aacgccgttctgaaacttctgagggagtttggctggggttgcgtttcagtttcggacgat
gaaatcagaaaagctcagaaaaggctcgcccgcgagggcctcttcgtccagccggcgagc
gcgacggggatagcggccttagagaagctcagccttcccgaaggagccaaggtcgtctcg
attctcaccggttctggattgagaaccctgaaagatgccccggcggggaagataacggag
tgcccgctcgaggggcttgaaaactgtctgaggtga

DBGET integrated database retrieval system