KEGG   Thermococcus sp. AM4: TAM4_1634Help
Entry
TAM4_1634         CDS       T01638                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tha  Thermococcus sp. AM4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TAM4_1634
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TAM4_1634
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TAM4_1634
Enzymes [BR:tha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TAM4_1634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(857812..858783)
Genome map
AA seq 323 aa AA seqDB search
MEAIKAACSGSYRSKEGLSESESEAGEGPGGLGRLFRATVLEELLGVREVYVDYEGVNPT
GTHKDRIALAHVGEAVKHGFPGITVGTCGNYGVAIAYYSALAGLKAVIFVPRDYTLERLP
EMRALGAEVIEVPGTYEEAVRASMAFARENGFYDANPGSNRAVDIRAYSEMALWIASRVN
PTAVFVPLGNGTTMAGLWEGFKAVGLAPRMVGVTTAFGNEILRRFYGDGNGDFAETELNE
PLVSERSFDADGALKAVRESNGYVFGFADDTALRCAELMRVVAGIRPLPASALVLAGLVK
FVRKFNLRNGRFVLVVTGGVRVG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaagccataaaagcagcctgctccggatcttataggtccaaagaaggtctttcagag
agtgaatctgaggcaggtgaggggcccggcggcctcggcagactcttccgtgccacggtt
ttggaggagctcctcggcgttagggaggtctacgtcgactacgagggcgtcaacccaacc
gggacccacaaggacaggatcgccctcgcccacgttggtgaggccgttaaacacggtttt
ccggggataacggtcggcacatgcggcaactacggcgtggcaatagcctattactccgcc
ctcgcgggcttgaaagcggtgatatttgttcccagagactataccctcgaaaggctcccc
gagatgagggcgctcggcgcggaggtcatcgaagttcccggcacctacgaggaggccgtc
agggccagcatggccttcgcgagggagaacggcttctacgacgccaacccgggaagtaac
cgcgccgttgatataagggcctactcggagatggccctctggattgcgtcaagggtgaac
cccaccgcggtcttcgtgcccctcggcaacgggacgacgatggcgggtctctgggagggg
tttaaggctgtcggtctggctccgaggatggtcggcgtgactaccgcttttggcaacgaa
atcctgaggaggttctacggcgatggaaacggagacttcgcggagacggaactcaacgag
cccctcgtttcggagaggtccttcgatgccgacggggcattgaaagccgtccgcgagtca
aacggctacgtcttcggattcgccgacgacaccgccctgaggtgtgccgagctgatgcgc
gtcgtggcagggataagaccccttcccgcgtcggctttagtgctggccggcctcgtgaag
ttcgtgaggaaatttaacctgagaaacggacggttcgtcctcgttgtcactgggggtgtc
cgggttggatga

DBGET integrated database retrieval system