KEGG   Thermococcus sp. AM4: TAM4_1634Help
Entry
TAM4_1634         CDS       T01638                                 

Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tha  Thermococcus sp. AM4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TAM4_1634
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TAM4_1634
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TAM4_1634
Enzymes [BR:tha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TAM4_1634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(857812..858783)
Genome map
AA seq 323 aa AA seqDB search
MEAIKAACSGSYRSKEGLSESESEAGEGPGGLGRLFRATVLEELLGVREVYVDYEGVNPT
GTHKDRIALAHVGEAVKHGFPGITVGTCGNYGVAIAYYSALAGLKAVIFVPRDYTLERLP
EMRALGAEVIEVPGTYEEAVRASMAFARENGFYDANPGSNRAVDIRAYSEMALWIASRVN
PTAVFVPLGNGTTMAGLWEGFKAVGLAPRMVGVTTAFGNEILRRFYGDGNGDFAETELNE
PLVSERSFDADGALKAVRESNGYVFGFADDTALRCAELMRVVAGIRPLPASALVLAGLVK
FVRKFNLRNGRFVLVVTGGVRVG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaagccataaaagcagcctgctccggatcttataggtccaaagaaggtctttcagag
agtgaatctgaggcaggtgaggggcccggcggcctcggcagactcttccgtgccacggtt
ttggaggagctcctcggcgttagggaggtctacgtcgactacgagggcgtcaacccaacc
gggacccacaaggacaggatcgccctcgcccacgttggtgaggccgttaaacacggtttt
ccggggataacggtcggcacatgcggcaactacggcgtggcaatagcctattactccgcc
ctcgcgggcttgaaagcggtgatatttgttcccagagactataccctcgaaaggctcccc
gagatgagggcgctcggcgcggaggtcatcgaagttcccggcacctacgaggaggccgtc
agggccagcatggccttcgcgagggagaacggcttctacgacgccaacccgggaagtaac
cgcgccgttgatataagggcctactcggagatggccctctggattgcgtcaagggtgaac
cccaccgcggtcttcgtgcccctcggcaacgggacgacgatggcgggtctctgggagggg
tttaaggctgtcggtctggctccgaggatggtcggcgtgactaccgcttttggcaacgaa
atcctgaggaggttctacggcgatggaaacggagacttcgcggagacggaactcaacgag
cccctcgtttcggagaggtccttcgatgccgacggggcattgaaagccgtccgcgagtca
aacggctacgtcttcggattcgccgacgacaccgccctgaggtgtgccgagctgatgcgc
gtcgtggcagggataagaccccttcccgcgtcggctttagtgctggccggcctcgtgaag
ttcgtgaggaaatttaacctgagaaacggacggttcgtcctcgttgtcactgggggtgtc
cgggttggatga

DBGET integrated database retrieval system