KEGG   Thermococcus sp. AM4: TAM4_1634Help
Entry
TAM4_1634         CDS       T01638                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tha  Thermococcus sp. AM4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tha01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tha00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:tha00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(857812..858783)
Genome map
AA seq 323 aa AA seqDB search
MEAIKAACSGSYRSKEGLSESESEAGEGPGGLGRLFRATVLEELLGVREVYVDYEGVNPT
GTHKDRIALAHVGEAVKHGFPGITVGTCGNYGVAIAYYSALAGLKAVIFVPRDYTLERLP
EMRALGAEVIEVPGTYEEAVRASMAFARENGFYDANPGSNRAVDIRAYSEMALWIASRVN
PTAVFVPLGNGTTMAGLWEGFKAVGLAPRMVGVTTAFGNEILRRFYGDGNGDFAETELNE
PLVSERSFDADGALKAVRESNGYVFGFADDTALRCAELMRVVAGIRPLPASALVLAGLVK
FVRKFNLRNGRFVLVVTGGVRVG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaagccataaaagcagcctgctccggatcttataggtccaaagaaggtctttcagag
agtgaatctgaggcaggtgaggggcccggcggcctcggcagactcttccgtgccacggtt
ttggaggagctcctcggcgttagggaggtctacgtcgactacgagggcgtcaacccaacc
gggacccacaaggacaggatcgccctcgcccacgttggtgaggccgttaaacacggtttt
ccggggataacggtcggcacatgcggcaactacggcgtggcaatagcctattactccgcc
ctcgcgggcttgaaagcggtgatatttgttcccagagactataccctcgaaaggctcccc
gagatgagggcgctcggcgcggaggtcatcgaagttcccggcacctacgaggaggccgtc
agggccagcatggccttcgcgagggagaacggcttctacgacgccaacccgggaagtaac
cgcgccgttgatataagggcctactcggagatggccctctggattgcgtcaagggtgaac
cccaccgcggtcttcgtgcccctcggcaacgggacgacgatggcgggtctctgggagggg
tttaaggctgtcggtctggctccgaggatggtcggcgtgactaccgcttttggcaacgaa
atcctgaggaggttctacggcgatggaaacggagacttcgcggagacggaactcaacgag
cccctcgtttcggagaggtccttcgatgccgacggggcattgaaagccgtccgcgagtca
aacggctacgtcttcggattcgccgacgacaccgccctgaggtgtgccgagctgatgcgc
gtcgtggcagggataagaccccttcccgcgtcggctttagtgctggccggcctcgtgaag
ttcgtgaggaaatttaacctgagaaacggacggttcgtcctcgttgtcactgggggtgtc
cgggttggatga

DBGET integrated database retrieval system