KEGG   Thermococcus sp. AM4: TAM4_1682Help
Entry
TAM4_1682         CDS       T01638                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tha  Thermococcus sp. AM4
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tha01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:tha00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
889715..890842
Genome map
AA seq 375 aa AA seqDB search
MELEEYVAGILRDIRERGIEAVREYSRKFDSYDGPFRVTDEEFEEAEKLVPEKDREIIER
TIGRLWDYHERQKPGDELFVKNGSLYGLIYRPIRRIGIYVPGGKPLPSTLMMVAVPARIA
GVKEIAVTIPPKDGRVNPYVLYVAKLLGIDEVYKLGGVQAIGAMAYGVGMKKVDKIFGPG
NRFVNEAKRQVFGVVGIDSLAGPSEIAVIADETAEKDYVLVDLLSQLEHGKDSKAWLLTT
SKELANFCSRDGIEVILCESLAECAEKTNEIAPEHLEIITEDPLSLVDLIENAGAIYLGP
YTPVPSADYFLGVNHVLPTGGTAKFSGVLTVRDFMKPITLARVSREEFLSERELGIRLAE
IEGMELHRRSMEVRR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgaggagtacgttgcgggcattttgagggacatacgcgaaaggggaatcgaa
gcggtcagggagtactctcggaagttcgacagctacgacggtccattccgcgtgacggat
gaggagttcgaggaggcggaaaagctcgttcccgagaaggacagggagataatcgagcgg
acgatagggcgactgtgggactaccacgaaaggcagaagccgggagacgagcttttcgtc
aagaacggctcgctctacggccttatctaccgcccgatacggaggataggaatctacgtt
cccggcgggaaaccgctcccctcgaccctcatgatggtcgccgttcccgcgaggatagcg
ggcgtcaaggagatagcggtcacgattccgccgaaggacggcagggtgaacccctacgtg
ctctacgtggcaaaactgctcggcatcgacgaggtttacaagctcggtggggttcaggcg
ataggggcgatggcgtacggcgttggaatgaagaaggtggacaagatattcgggcccgga
aacaggttcgtcaacgaggccaagaggcaggtgttcggcgtcgtgggaatagacagcctc
gccgggccgtcggagatagcggtcatagccgatgaaacggccgagaaggactacgtcctg
gtggacctcctcagccagctggagcacgggaaggacagcaaagcatggcttctgacgacc
tcgaaggagcttgccaacttctgctcccgcgacgggattgaggtgatactctgcgaaagc
ctcgcggagtgcgccgaaaagacgaacgagatagcgccggagcaccttgagataataacc
gaagacccgctcagcctggttgacctcatcgagaacgccggggcgatttacctcggaccc
tacacgcccgttccctcagctgattacttcctcggcgtcaaccacgtccttccgaccgga
ggaacggcaaagttcagcggggttctaacggtgagggacttcatgaagccgataaccctc
gcccgggtgagcagggaggagtttctgagcgaaagggagcttggaataagattggcggag
atagagggcatggaacttcacaggaggagcatggaggtgaggagatga

DBGET integrated database retrieval system