KEGG   Thermococcus sp. AM4: TAM4_1729Help
Entry
TAM4_1729         CDS       T01638                                 

Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tha  Thermococcus sp. AM4
Brite
Enzymes [BR:tha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TAM4_1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 RrnaAD MTS GCD14 CMAS Methyltransf_3 PrmA Methyltr_RsmB-F Fibrillarin Ubie_methyltran Met_10 Methyltransf_16 Methyltransf_2
Motif
Other DBs
NCBI-ProteinID: EEB74362
UniProt: B7R1L0
Position
835053..835712
Genome map
AA seq 219 aa AA seqDB search
MREEELRELWKRTVRRLELEGILRDERVKEALLKWPRYLFVEDKYRKYAHLDEPLPIPGG
QTISAPHMVAIMLQLADLRPGMNVLEIGTGSGWNAALMAELVKGEVYTVERLPELVEFAR
ENLERAGVKGVHVIPGDGSKGFPPKAPYDRIVVTAGAPEVPKPLIEQLKPGGKLIIPVGS
YHLWQDLLEVIKLADGSIKIRNHGGVAFVPLIGEYGWRE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagggaagaggaactcagggagctctggaagagaacggttcgaaggcttgaactggag
ggtattctgcgcgatgaacgggttaaggaggccctcctgaaatggccccgctacctcttc
gtcgaggataaataccggaaatacgcccatctggacgaacctctgccaattcccggggga
cagacgataagcgcgccgcatatggtggcgataatgctccagctcgcagatctaaggccc
ggtatgaacgtcctggagataggcaccgggagcggatggaacgcggcactgatggccgag
ctcgtaaagggagaggtatacacggttgaaaggcttcccgagctcgtcgagtttgcaagg
gagaacctagagcgggcgggagttaagggagtccacgttattcccggagacggcagcaag
ggctttcccccaaaagctccttacgacaggatagtggttacggcaggggcgccggaagtg
ccgaagcccctcatagaacagcttaaacccgggggcaaactgataatcccggttggaagc
taccacctgtggcaggatctccttgaggttatcaaactggcggacggctcgataaaaata
agaaaccacgggggagtggccttcgtcccgctgataggggagtacgggtggagggaataa

DBGET integrated database retrieval system