KEGG   Thermococcus sp. AM4: TAM4_178Help
Entry
TAM4_178          CDS       T01638                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tha  Thermococcus sp. AM4
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tha01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tha00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1100036..1101853
Genome map
AA seq 605 aa AA seqDB search
MYGNWGKFLRVNLSTGEVKVEEYDEELAKKWVGSRGLAIYYLLRDMDPKVDPLSPENIMV
ITPGPLSGTSAPTGGRYNVVTKSPATGFITMANSGGYFGAELKFAGWDGIIIEGKAESPV
YIYIKDENVEIRDASHLWGKVVSETEETLRKEIGSKKIRILSIGPAGENLVKFAAIMNDG
HRAAGRGGVGAVMGSKNLKAIVAEGSKRVPIADKQKFMLTVREKINKLKNDPVAGGGLPN
YGTAVLVNIINENGLYPTRNFQTGVFEHAYEQSGEAMAKKYLIRNQPCYACPIGCGRVNK
LPTVGVTEGPEYESIWALGANLGINDLASIIEANHQCDEFGLDTISTGGTLAAAMELYEK
GYLTDDDLGDAPPFRWGNTEVLHYYIEKIAKREGLGDKLAEGSYRFAEMYGHPEYSMSVK
KLELPAYDPRGAEGHGLGYATNNRGGCHIKNYMISPEILGYPYKMDPHDISDDKVKMLIL
FQDLSALIDAAGLCLFTTFGLGADDYRDMLNAALGWDFSTEDYLKVGERIWNAERIFNLK
AGLDPLKDDTLPKRFLEEPMPEGPNKGHVVRLKEMLPRYYALRGWTEDGRVPPEKAEELG
IKEFL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtacgggaactggggtaagtttctgcgcgtgaacctctccacgggagaggtcaaggtt
gaggagtacgacgaggagctggccaagaagtgggtcggcagcaggggactggcgatatac
tacctcctaagggacatggacccgaaggtcgatccgctgagcccggagaacatcatggtg
ataacacccggcccgctgagcggaaccagcgcgccgaccggcggcaggtacaacgtcgtc
acgaagagcccggcgacgggattcataacaatggccaactcaggaggctacttcggcgcc
gaactcaagtttgccggatgggacgggatcataatcgaaggaaaggccgagagcccggtt
tacatctacataaaggacgaaaatgtcgagatcagggacgcctcacacctgtggggcaag
gtcgtgagtgagaccgaggagacgctgaggaaagaaatcggtagcaagaagatcagaatc
ctgagcataggcccggccggagagaacctcgtcaagttcgcggccataatgaacgacggc
cacagggcggcgggcaggggcggcgtcggtgccgtcatgggaagcaagaacctcaaggca
atagttgccgagggaagcaagagggtccccatagcggacaagcagaagttcatgctcacc
gtcagggagaagataaacaagctcaagaacgaccctgtcgcaggcggcggcctgcccaac
tacggaaccgcggttctcgtgaacatcatcaacgagaacggactctacccgacgaggaac
ttccagaccggtgtcttcgagcacgcctacgagcagagcggtgaggcgatggccaagaag
tacctcataaggaaccagccgtgctacgcctgtccgataggctgtggaagggttaacaag
ctgccaaccgttggcgttaccgaaggccccgagtacgagagcatatgggccctcggtgca
aacctgggcataaacgacctggcgagcataatcgaggccaaccaccagtgtgacgagttc
ggcctcgacacgatctcaaccggtggaactctcgctgccgccatggagctctacgagaag
ggctacctaaccgacgacgaccttggcgacgctccgcccttcaggtggggcaacaccgag
gttctgcactactacatcgagaagatagcgaagagagaaggacttggagacaaactcgcc
gagggaagctaccgcttcgccgagatgtacggccacccggagtactcgatgagcgtcaag
aagcttgagcttcccgcctatgacccgaggggagccgagggacacggcctcggttacgcg
accaacaaccgcggtggatgccacatcaagaactacatgataagccccgagatcttaggt
tacccgtacaagatggacccgcacgacataagcgacgacaaggtgaagatgctcatcctc
ttccaggacctcagcgcgctcatagatgcggccggcctgtgcctcttcacgaccttcgga
ctcggtgcggacgactaccgcgacatgctcaacgctgctttgggctgggacttctccacc
gaggactacctcaaggtcggagagaggatctggaacgcggagaggatcttcaacctcaag
gccggcctcgacccgctcaaggacgacaccctgccgaagaggttcctagaggagccgatg
ccggagggtccgaacaagggccacgtcgttcgcctgaaggagatgctgccgagatactac
gcgctccgcggctggaccgaggacggaagggtcccgcccgagaaggcggaagagctcggc
atcaaggagttcctctga

DBGET integrated database retrieval system