KEGG   Thermococcus sp. AM4: TAM4_2355Help
Entry
TAM4_2355         CDS       T01638                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tha  Thermococcus sp. AM4
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TAM4_2355
Enzymes [BR:tha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     TAM4_2355
    3.5.1.-  
     TAM4_2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(415554..416105)
Genome map
AA seq 183 aa AA seqDB search
MPEEALIVVDMQRDFMPGGALPVPGGDEIIPIVNECVKKFRERGALIVATRDWHPPDHIS
FRERGGPWPRHCVQNTPGAEFVVELPEDAIIISKATEPDKEAYSGFEGTNLAEVLREKGV
KRVYVCGVATEYCVKATALDAVKHGFETYLLTDAVKGINPEDERKALEELQRAGVKLIRC
SSL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggaggccctcatagttgtagacatgcagagggatttcatgcccgggggagct
cttcccgttcccgggggagacgagataattcccatcgtgaacgagtgcgtgaagaaattc
cgggagaggggagccctgatagtcgccaccagggactggcatccaccggatcacatcagt
ttcagagaacggggcggcccctggccgagacactgcgttcagaacacgcccggcgcggag
ttcgttgtggagctgccagaggacgcgatcataatctcgaaggcaacggaacccgacaag
gaggcgtattccggcttcgaggggacgaacctagcggaggtactcagggagaagggtgtt
aagcgtgtctacgtctgcggggttgccacggagtactgcgtgaaggcgacggctttagat
gctgtaaaacacggctttgaaacttacctcctaaccgacgccgtcaagggcatcaacccc
gaggacgagagaaaagcgctcgaagagctccagcgcgcgggagtgaagctaatccgctgc
tcctccctctga

DBGET integrated database retrieval system