KEGG   Thermococcus sp. AM4: TAM4_288Help
Entry
TAM4_288          CDS       T01638                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tha  Thermococcus sp. AM4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TAM4_288
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TAM4_288
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TAM4_288
Enzymes [BR:tha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TAM4_288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1255341..1256669
Genome map
AA seq 442 aa AA seqDB search
MKAVLPDSKIPKRWYNILPDLPEELAPPLDPETDEPMRPEKLLRIFAEELVKQEMSTERY
IEIPKKVRELYAKIGRPTPLFRATNLEKALGTPARIYFKYEGATVTGSHKINTALAQAYY
AKEQGIERLVTETGAGQWGTALSLAGALLGLKVRVYMARASYFQKPYRKTIMRLYGAEIY
PSPSDRTEIGRKFLSEDPNHPGGLGIAISEAIEDVLRDEKARYALGSVLNHVLMHQTVIG
LEAQEQMKEFEEPDVIIGCVGGGSNFAGLAYPFVRDVLSGEKEYEFIAVEPKAAPSMTRG
VYKYDFGDSGGYTPKMKMHTLGHTYYVPPIHAGGLRYHGLAPTLSVLINHGIVRPVAYHQ
NEVFQAAELFAKTEGIIPAPESAHAIKGVIDRALKAKEEGKEEVILFNLSGHGLLDLKGY
EDYLDGKLEDYEPDYFPALEEP
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgttctgcccgattcgaagataccaaagagatggtacaacatactgcccgat
ctgccagaggagctggctccgcccctcgacccggaaaccgacgagccgatgaggccggag
aagctgttgaggattttcgcagaggagctggtaaagcaggagatgagcacggaaaggtac
atcgagattccgaagaaggttcgcgagctctacgccaagataggcaggcccacaccgctt
ttcagggcgacaaaccttgagaaggcccttggcacaccggcgaggatttacttcaaatac
gaaggcgccactgtaacggggagccacaagataaacaccgctttagctcaggcctactac
gcgaaggagcagggaatagagaggctcgttactgaaacgggagccggccagtggggaacc
gctttgagcctggccggtgctcttctcgggttaaaagttcgcgtttacatggcgcgcgcc
agttacttccagaaaccatacaggaagacgataatgcgcctctacggggccgaaatctat
cccagtccaagcgacagaacggaaatcgggaggaagttcctgagcgaggatcccaaccac
cccggagggctgggaatagcgataagcgaggcgattgaagacgttttgagggacgaaaaa
gcccgctacgccctcggaagcgttttgaaccacgtgctcatgcaccagaccgtcatcggc
ctcgaagctcaggagcagatgaaggagttcgaggagccggacgttataatcggctgtgta
ggcggtgggagcaacttcgctggccttgcgtatcccttcgtgagggacgttctgagcggt
gaaaaggagtacgagttcatagcggtcgagccgaaagccgccccgagcatgacgcgcggt
gtctacaagtacgacttcggcgactccggtggttacaccccaaagatgaagatgcacacc
ctcggccacacctactacgtcccgccgattcacgctggagggcttcgctaccacggctta
gctccgacgctgagcgtcctcataaaccacggaatagtcaggccagtagcttaccaccag
aacgaggtcttccaggcggcggagctgttcgcgaagaccgagggcataatcccagcaccc
gaaagcgcccacgcgataaagggcgtcatagacagggcgttaaaggcgaaggaagaagga
aaggaggaggtcatactcttcaacctgagcggccacggcctgctcgacctgaagggctac
gaggactacctggacgggaagctcgaagattatgagccggactacttcccggctctggag
gagccttag

DBGET integrated database retrieval system