KEGG   Thermococcus sp. AM4: TAM4_288Help
Entry
TAM4_288          CDS       T01638                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tha  Thermococcus sp. AM4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tha01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tha00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:tha00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1255341..1256669
Genome map
AA seq 442 aa AA seqDB search
MKAVLPDSKIPKRWYNILPDLPEELAPPLDPETDEPMRPEKLLRIFAEELVKQEMSTERY
IEIPKKVRELYAKIGRPTPLFRATNLEKALGTPARIYFKYEGATVTGSHKINTALAQAYY
AKEQGIERLVTETGAGQWGTALSLAGALLGLKVRVYMARASYFQKPYRKTIMRLYGAEIY
PSPSDRTEIGRKFLSEDPNHPGGLGIAISEAIEDVLRDEKARYALGSVLNHVLMHQTVIG
LEAQEQMKEFEEPDVIIGCVGGGSNFAGLAYPFVRDVLSGEKEYEFIAVEPKAAPSMTRG
VYKYDFGDSGGYTPKMKMHTLGHTYYVPPIHAGGLRYHGLAPTLSVLINHGIVRPVAYHQ
NEVFQAAELFAKTEGIIPAPESAHAIKGVIDRALKAKEEGKEEVILFNLSGHGLLDLKGY
EDYLDGKLEDYEPDYFPALEEP
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgttctgcccgattcgaagataccaaagagatggtacaacatactgcccgat
ctgccagaggagctggctccgcccctcgacccggaaaccgacgagccgatgaggccggag
aagctgttgaggattttcgcagaggagctggtaaagcaggagatgagcacggaaaggtac
atcgagattccgaagaaggttcgcgagctctacgccaagataggcaggcccacaccgctt
ttcagggcgacaaaccttgagaaggcccttggcacaccggcgaggatttacttcaaatac
gaaggcgccactgtaacggggagccacaagataaacaccgctttagctcaggcctactac
gcgaaggagcagggaatagagaggctcgttactgaaacgggagccggccagtggggaacc
gctttgagcctggccggtgctcttctcgggttaaaagttcgcgtttacatggcgcgcgcc
agttacttccagaaaccatacaggaagacgataatgcgcctctacggggccgaaatctat
cccagtccaagcgacagaacggaaatcgggaggaagttcctgagcgaggatcccaaccac
cccggagggctgggaatagcgataagcgaggcgattgaagacgttttgagggacgaaaaa
gcccgctacgccctcggaagcgttttgaaccacgtgctcatgcaccagaccgtcatcggc
ctcgaagctcaggagcagatgaaggagttcgaggagccggacgttataatcggctgtgta
ggcggtgggagcaacttcgctggccttgcgtatcccttcgtgagggacgttctgagcggt
gaaaaggagtacgagttcatagcggtcgagccgaaagccgccccgagcatgacgcgcggt
gtctacaagtacgacttcggcgactccggtggttacaccccaaagatgaagatgcacacc
ctcggccacacctactacgtcccgccgattcacgctggagggcttcgctaccacggctta
gctccgacgctgagcgtcctcataaaccacggaatagtcaggccagtagcttaccaccag
aacgaggtcttccaggcggcggagctgttcgcgaagaccgagggcataatcccagcaccc
gaaagcgcccacgcgataaagggcgtcatagacagggcgttaaaggcgaaggaagaagga
aaggaggaggtcatactcttcaacctgagcggccacggcctgctcgacctgaagggctac
gaggactacctggacgggaagctcgaagattatgagccggactacttcccggctctggag
gagccttag

DBGET integrated database retrieval system