KEGG   Thermococcus sp. AM4: TAM4_312Help
Entry
TAM4_312          CDS       T01638                                 

Definition
Asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tha  Thermococcus sp. AM4
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TAM4_312
Enzymes [BR:tha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     TAM4_312
Peptidases [BR:tha01002]
 Cysteine Peptidases
  Family C44
   TAM4_312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1212862..1214301)
Genome map
AA seq 479 aa AA seqDB search
MCLIAGGIGEIRERLIKMALAGKHRGPDSFGVWTDEGVLKSDDFSKLGQIPGGRIGLLQC
RLAMTGSKAFTQPFVNELALVHNGEVYNHAQIRAFLEGRGVSFESDVDSEVILRLIEFLR
GKGLSFPQAVREAMRWIEGDYAVAFSDGERIYLFRDPVGIRPLYFSPNGFFASEKKVLWA
IGEEAVPVEPGSLVTISRGGVEVSRLLSVEDLRPGTFTAERALGSLLRTIPYSVRIRCGR
KTGVLFSGGLDSSLIALLASKHSDVVLYTAGAEGSQDLEWARKVSELLGLELREYVFTEE
DVEEALKRIVFAMEEPNAMNLAIGVPLYFSTLLAARDDVRVLLSGQGADELFGGYAKYVE
KPWLMEEDLRELAERNLARDDKIAMLNGVEGRFPYLALPVVTAALGIPVELKIRNGVRKF
ILRNAAEKLGLPKEVVEREKKAAQYGSGAQKILKRIGKRRGLSPRDLALQLFREVFHSS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttgattgccggtggaatcggggagatcagggaaaggctcatcaaaatggccctc
gctgggaaacaccgggggccggacagcttcggcgtctggaccgacgagggagtgctgaag
tcggacgatttttcaaagctgggccagatcccgggcgggaggatagggctccttcagtgc
aggctggccatgacgggctcgaaggcctttacccagcccttcgttaacgagttagcttta
gtgcacaatggtgaggtttacaatcacgcccagatccgggcgtttttagagggaaggggc
gtttccttcgagagcgacgttgacagcgaggtaatcctcaggctcatcgagtttctgagg
gggaaaggccttagcttcccccaggccgtgagggaggcgatgcgctggatcgagggcgac
tacgcggtggcgttctcggacggcgagaggatctacctgttccgcgatcccgtcgggata
aggcccctctacttctcccccaacggcttcttcgccagcgagaagaaggtcctctgggcg
atcggtgaggaggccgttcccgttgagccgggcagtctcgtgaccatctcgcgggggggc
gttgaggtaagccgcctcctgagcgttgaggatctaaggccagggaccttcacggcggag
agggctttgggctcgctcctgaggacgatcccctactccgtgaggataaggtgcggaagg
aaaactggggttctcttctcggggggccttgacagctcgctgatcgctctccttgcctct
aaacactcggacgttgtgctttacacggccggagccgagggcagtcaggatctcgagtgg
gcgaggaaggtgagcgaactcctcgggctggagctcagggagtacgtcttcaccgaggag
gacgttgaggaagccctgaaacggatcgttttcgccatggaggaaccaaacgccatgaac
ctcgccatcggtgttcccctctacttctcgaccctgctcgcggcgagggacgatgtcagg
gttctcctgagcgggcagggggcggacgagctcttcgggggctacgctaagtacgttgag
aagccctggctcatggaggaggacctcagggagctggccgagaggaacctcgcgagggac
gacaagatagcgatgctcaacggcgtggagggtcgtttcccatatcttgcgctccccgtc
gtcacggccgcccttggaatcccggtcgagcttaagatacggaacggggtcagaaagttc
atcctgcggaacgccgccgaaaaactcggacttccgaaggaagttgtggagagggagaaa
aaggccgcacagtacggcagcggtgctcaaaagatcctcaaaaggatcggaaagaggagg
ggcctctcgccgagggatctcgcccttcagctcttcagggaggtctttcactcctcctga

DBGET integrated database retrieval system