KEGG   Thermococcus sp. AM4: TAM4_447Help
Entry
TAM4_447          CDS       T01638                                 

Definition
(GenBank) endoglucanase M
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
tha  Thermococcus sp. AM4
Brite
Enzymes [BR:tha01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     TAM4_447
Peptidases [BR:tha01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   TAM4_447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(121817..122863)
Genome map
AA seq 348 aa AA seqDB search
MVDFELLKKIVEAPGVSGYEFLGVRDVVIEAFKPYVDEIRVDKLGNVIAHKEGKGPKVML
AGHMDQIGLMVTHIEKNGFLRVAPVGGVDPRTLIAQRFKVWIGKNKFIYGVGGSVPPHIQ
KPEDRKKAPTWEQVFIDIGAESKEEAEEMGVRIGTVITWDGRLERLGKHRLVSIAHDDRI
AVYTLVEAARQLSETDADVYFVATVQEEVGLRGAKVSAFGIDPDYGFALDVTIAADVPGT
PEHKQISQLGKGVAIKIMDRSVICHPTIVRWMEELAKKHEIPYQWDILTGGGTDAGAIHL
NKAGVPTGGISIPARYIHSNTEVVDERDVDAAVKLTVKILEEIPGLKL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggttgacttcgaactgctgaagaagattgttgaagccccgggagtttctggctacgag
tttttgggagttagggacgttgtaatcgaggccttcaagccctacgtcgacgagatcagg
gtcgacaagctcggaaacgtcatagcgcacaaggaagggaagggcccgaaggtcatgctc
gccggacatatggaccagatcggccttatggtgacccacatcgagaagaacgggttctta
agggtggcaccggttggcggcgttgacccgaggacgctgatagcccagcgcttcaaggtc
tggataggcaagaacaagttcatctacggcgtcggtggaagcgttccccctcacatccag
aagcccgaggacaggaaaaaagccccgacctgggagcaggtcttcatcgacatcggtgca
gagagcaaagaggaagccgaggagatgggcgttaggataggcactgtcatcacctgggac
ggtcgcttggagcgccttggaaagcacaggctcgtcagcatcgcccacgacgacaggata
gccgtttacaccctcgttgaggcggccaggcagctgagcgagaccgacgcggacgtctac
ttcgtcgcaaccgttcaggaggaggtaggactcaggggagcgaaggtttcggcgttcggc
atagacccggactacggcttcgccctcgacgtcaccatagcggccgacgtcccgggaacc
ccggagcacaagcagataagccagctcggaaagggcgtcgcgattaagataatggaccgc
tccgtcatctgccacccgacgattgtcaggtggatggaagagctcgcgaaaaagcacgag
ataccctaccagtgggacatcctcaccggcggaggaaccgacgcaggagccatacacctc
aacaaggccggcgtcccaacgggcggcataagcattccagcgcgctacatacactccaac
accgaggtcgttgacgagcgcgacgtcgatgcggccgttaagctcacggtcaagattctt
gaggagattccggggctgaagctctga

DBGET integrated database retrieval system