KEGG   Thermococcus sp. AM4: TAM4_447Help
Entry
TAM4_447          CDS       T01638                                 

Definition
endoglucanase M
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tha  Thermococcus sp. AM4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TAM4_447
Enzymes [BR:tha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     TAM4_447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(121817..122863)
Genome map
AA seq 348 aa AA seqDB search
MVDFELLKKIVEAPGVSGYEFLGVRDVVIEAFKPYVDEIRVDKLGNVIAHKEGKGPKVML
AGHMDQIGLMVTHIEKNGFLRVAPVGGVDPRTLIAQRFKVWIGKNKFIYGVGGSVPPHIQ
KPEDRKKAPTWEQVFIDIGAESKEEAEEMGVRIGTVITWDGRLERLGKHRLVSIAHDDRI
AVYTLVEAARQLSETDADVYFVATVQEEVGLRGAKVSAFGIDPDYGFALDVTIAADVPGT
PEHKQISQLGKGVAIKIMDRSVICHPTIVRWMEELAKKHEIPYQWDILTGGGTDAGAIHL
NKAGVPTGGISIPARYIHSNTEVVDERDVDAAVKLTVKILEEIPGLKL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggttgacttcgaactgctgaagaagattgttgaagccccgggagtttctggctacgag
tttttgggagttagggacgttgtaatcgaggccttcaagccctacgtcgacgagatcagg
gtcgacaagctcggaaacgtcatagcgcacaaggaagggaagggcccgaaggtcatgctc
gccggacatatggaccagatcggccttatggtgacccacatcgagaagaacgggttctta
agggtggcaccggttggcggcgttgacccgaggacgctgatagcccagcgcttcaaggtc
tggataggcaagaacaagttcatctacggcgtcggtggaagcgttccccctcacatccag
aagcccgaggacaggaaaaaagccccgacctgggagcaggtcttcatcgacatcggtgca
gagagcaaagaggaagccgaggagatgggcgttaggataggcactgtcatcacctgggac
ggtcgcttggagcgccttggaaagcacaggctcgtcagcatcgcccacgacgacaggata
gccgtttacaccctcgttgaggcggccaggcagctgagcgagaccgacgcggacgtctac
ttcgtcgcaaccgttcaggaggaggtaggactcaggggagcgaaggtttcggcgttcggc
atagacccggactacggcttcgccctcgacgtcaccatagcggccgacgtcccgggaacc
ccggagcacaagcagataagccagctcggaaagggcgtcgcgattaagataatggaccgc
tccgtcatctgccacccgacgattgtcaggtggatggaagagctcgcgaaaaagcacgag
ataccctaccagtgggacatcctcaccggcggaggaaccgacgcaggagccatacacctc
aacaaggccggcgtcccaacgggcggcataagcattccagcgcgctacatacactccaac
accgaggtcgttgacgagcgcgacgtcgatgcggccgttaagctcacggtcaagattctt
gaggagattccggggctgaagctctga

DBGET integrated database retrieval system