KEGG   Thermococcus sp. AM4: TAM4_548Help
Entry
TAM4_548          CDS       T01638                                 

Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tha  Thermococcus sp. AM4
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tha00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1874601..1875458
Genome map
AA seq 285 aa AA seqDB search
MEFLYTYEAFKLELPLVPPERADFVILGVPFDGTTSYKSGARFGPTLIRQATLNLETYVL
DYDVDVSSVGVADIGDVAVVAGNPRETADRVRETVEELKKANPRAIPVLLGGEHSQTLGA
VEALKPKSYVVFDAHLDLRDSYEDNPYNHACVARRIAELGVREAMFGIRSGTRDEVEFAE
KNGIRWVHARDYGFDSFVDLVEPLPEPVYLSVDIDVFDVSMVPDTGTPEAGGLRFWEVIE
AIEWLTANKRIAGFDIMEVAGERLGNPTALTAAKLLFYFLAMMKR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtggagttcctgtacacgtacgaggcctttaagctcgagcttcccctcgttcctcctgag
cgagcggacttcgttatcctcggggtgcccttcgacggcacaaccagctacaagtccgga
gcgcgcttcgggccgacgctgataagacaggccacgctgaacctggaaacctacgttctt
gactacgacgtggacgtttcgagcgtgggggtggcggacataggcgacgttgcggttgtg
gcggggaatcctcgcgaaaccgcggacagggttagggaaaccgttgaggagctgaaaaaa
gcgaatccccgcgcgataccggtactcctcggcggcgagcactcccagacgcttggggcc
gttgaggcattgaagccaaaaagctacgtggtcttcgatgctcacctcgacctcagggac
agctacgaggacaacccctacaaccacgcctgcgtcgccaggagaatagccgagctgggc
gttagagaggcaatgttcgggataaggagcgggacgagggatgaagttgaattcgccgag
aaaaatggaattcgatgggttcacgccagggactacggcttcgattccttcgtggatctc
gttgagccccttccggagccggtttacctctcggtggacatagacgtctttgatgtttca
atggttccggacacgggaacgcccgaagccggaggcctgaggttctgggaggtaatagag
gcaatcgaatggctcacggccaacaaaaggatagcgggcttcgacataatggaggttgcg
ggggagaggctggggaacccaaccgccctgacggccgcgaagctgctgttttacttcctg
gcaatgatgaaaaggtga

DBGET integrated database retrieval system