KEGG   Thermococcus sp. AM4: TAM4_573Help
Entry
TAM4_573          CDS       T01638                                 

Definition
Tungsten-containing ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tha  Thermococcus sp. AM4
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TAM4_573
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TAM4_573
Enzymes [BR:tha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TAM4_573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54639..56504
Genome map
AA seq 621 aa AA seqDB search
MYGYKNRIARVNLTEGKVTYEELPDEVIRKFVGGKGLGYYLIYREVPPGTDPLSPANKFV
FATGGLTGLIPGSSKVIAVSKSPETRLISDSSGGDAFGPKLKGHFDAIIIEGKAEEPVYL
YIHDGEVEIRNAKHLWGRGNYEVAKELWKEHPKASLALIGPAGERLSRIANVIYDTERAS
GRGGLGAVLGSKKVKAVVVEPGEKPTVASPEEFQKLWQEFYEHFATDPKYEHLRNYGTSD
GVRSSASLGMSPAYNFSRPYIPEELAEKLSGDEVKKYEVEPEWFVHGKSCPIKCARYVEV
EYKGRRIRVKPEYESIAMLGASTGVFNFPAVAYFNWLVNNLGLDSIATGNTIAWFFELVE
RGLISEEEIGFPVRGFGDEEAEERLIKLMAERRGIGAILADGVKRACERLGRGCEFAVHV
KGMEAPAWDPRGRRTYALSYATADVGASHLRGWPRPHQLPNQGPAKELVPSMIEGRDESY
ITDMLGTCKFVSYKMEDLAKFYSLATGEEWTVERLRKIAQAVESIARIHDALDWVTPPLD
DTIPPRWWEPEPDGPAKGNKAFIDYNDFLEARREFYRLRGWHEELGVPLPETMEELGYPE
FREDAEKALEVVKKRAGIQIS
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtatggatacaagaacaggatagcgagagtaaacctgaccgagggaaaggtcacctac
gaggaactgcccgacgaggtgataaggaagttcgtcggcggaaagggcctcggctactac
ctgatttatcgggaggtcccgccgggaaccgacccgctcagcccggccaacaagttcgtt
ttcgccaccggtggattgacaggcctgattccgggttcgagcaaggtcatagccgttagc
aagagccctgagacgagacttataagcgattcaagcggtggagacgccttcggacccaag
ctcaaggggcacttcgacgcgataatcatcgaaggtaaggcggaagagccggtttacctc
tacatccatgatggggaggtcgaaatccggaatgcgaagcacctctggggcaggggcaac
tacgaggttgccaaggaactctggaaggagcacccgaaggcaagcctagctttaattggc
ccggccggcgagaggctcagcagaattgccaacgtgatttacgacaccgagcgcgcgagc
ggaaggggcggtcttggagccgtcctcgggagcaagaaggttaaggccgttgtggttgag
ccgggggagaagccaacggttgccagcccggaggagttccagaaactgtggcaggagttc
tacgagcacttcgcgacagacccgaagtacgagcacctgaggaactacgggacgagcgac
ggagttaggagctccgcctcgctcggaatgagcccggcctataacttctcaaggccatac
atcccggaggagctggcggagaagctgagcggggacgaggtcaagaagtacgaggtagag
ccggagtggttcgtccacggcaagagctgtccgattaagtgcgccaggtatgtagaggtc
gaatacaagggcaggagaatccgcgtcaagcccgagtacgagagcatcgcgatgcttgga
gcgtcaacgggcgtcttcaactttccagcggtagcctacttcaactggctcgtcaacaac
ctcggcctcgacagcatagcgaccggcaacacaatagcctggttctttgagctggtcgag
aggggcctcataagcgaggaggagatagggttccctgtcaggggcttcggcgacgaggag
gccgaggagaggctcatcaagctgatggccgagaggaggggcattggagcgattctcgcc
gatggcgtgaagagggcctgcgagaggctcggcagaggttgcgagttcgccgtgcacgtg
aagggcatggaagcgcccgcatgggacccgcgcggaaggaggacctacgccctcagctac
gccaccgccgacgttggagcgtctcacctgaggggctggccgaggccccatcagctaccg
aaccaggggccggcgaaggagctcgtgccgtcgatgatagagggcagggacgagagctac
atcaccgacatgctcggaacgtgcaagttcgtgtcctacaagatggaagacctggctaag
ttctactcgctcgcgaccggcgaggaatggacggtcgagaggctaaggaaaattgctcag
gccgttgagagcatcgcgcgcatacacgacgccctcgactgggtgacgcctccgctcgac
gacacgattccaccgcgctggtgggagccggagccggacgggccggccaagggcaacaag
gccttcatcgactacaacgacttccttgaggcgaggagagagttctacaggctcagggga
tggcacgaggagctcggcgtcccgttgccggagacgatggaagagctcggctatccggag
ttcagggaagatgccgagaaggctttggaagtcgtaaagaagagggctggcatccagatc
tcctga

DBGET integrated database retrieval system