KEGG   Thermococcus sp. AM4: TAM4_90Help
Entry
TAM4_90           CDS       T01638                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tha  Thermococcus sp. AM4
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TAM4_90
Enzymes [BR:tha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TAM4_90
Exosome [BR:tha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TAM4_90
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1267056..1268537)
Genome map
AA seq 493 aa AA seqDB search
MERYILSLDEGTTSARAIIFDRESNIIGLGQYEFPQHYPRPGWVEHNPEEIWDAQFRAIK
TALERAKIEPSQIAAIGVTNQRETTIVFDRDGKPLYNAIVWQCRRTAELIEEIKREYGDM
IKQKTGLVPDAYFSASKLKWLLDNVPGLREKAEKGEVLFGTVDTFLIYRLTGEHVTDYSN
ASRTMLFNIKRLDWDDELLEIFGIPEEVLPEVKESSEVYGYTKKELLGTEIPVSGDAGDQ
QAALFGQAGFETGMVKATYGTGSFILANTGKTVRYSDNLLTTIAWGLNGKVTYALEGSVF
VTGAAVQWLRDGIKIIKHASETEELARKLESNEGVYFVPAFVGLGAPYWDQFARGLIIGI
TRGTGREHLARATLEAIAYLTRDVIEEMEKLVGIKELRVDGGATANDFLMQFQADILNRR
VVRPVVKETTALGAAYLAGLAVDYWESLEEIESLWKAEKVFEPGMDEETRRKLYHGWKEA
VKRAMGWAKVVGV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctatatcctctcactcgacgagggaactacttccgcgagggcgataatcttc
gacagggagagcaacatcatcggcctcggtcagtacgagtttccccagcactatccgagg
cccggctgggtggagcacaatccggaggaaatctgggacgcgcagttcagggccataaag
actgcccttgagcgggcgaaaatagagccaagtcaaatagcggcgattggcgttactaac
caaagagaaactacgatagtctttgaccgcgacggaaaaccgctctacaacgcgatagtc
tggcagtgcaggagaacggccgagcttatcgaggagataaagcgcgaatacggggatatg
ataaagcagaagaccggcctcgtccccgacgcttacttctccgcgagcaagctcaagtgg
ctcctcgacaacgttccaggcttaagggagaaggcggagaagggcgaagtcctctttgga
accgtcgacactttcttaatctaccgcctcactggagagcacgtaaccgattactccaac
gcctcaaggacgatgctcttcaacataaagaggctcgactgggatgacgaactccttgaa
atcttcgggatcccggaggaggttctgccggaagtgaaggagtcgagcgaggtctacggc
tacacgaagaaggaactcctcgggacggagattccggtgagcggcgatgcaggagaccag
caggcggctctgttcgggcaggcgggcttcgagaccggaatggtgaaggccacctacgga
acgggaagcttcattttagcaaacaccggaaagaccgtccgctactccgataatctgctc
acgacaatagcctggggactcaacggaaaggttacctatgccctcgagggaagcgttttt
gtaacgggagcagcggttcagtggctccgcgacggaataaagattatcaagcacgcctcc
gaaaccgaggaactcgcgaggaagctcgagagcaacgaaggagtctacttcgtcccggct
ttcgtcggccttggagcaccgtactgggaccagttcgcacgggggctgataatcggtata
acgcgtggaaccggcagggagcacctcgcaagggcaactctggaggcgatagcctatctc
acgcgcgacgtcatagaggagatggagaagctcgtcgggataaaggagctccgcgttgac
ggcggggccacggcgaacgacttcctgatgcagttccaggcggacatactgaacaggcgc
gttgtcaggcccgtcgtcaaggaaaccaccgcgctcggcgcggcgtatctggccggactg
gccgtcgattactgggagagccttgaggagatagagagcctctggaaggcggagaaggtg
ttcgagccggggatggacgaggaaacaaggagaaagctctatcacggctggaaggaggcg
gtaaagagggccatgggctgggcgaaggtcgttggggtctga

DBGET integrated database retrieval system