KEGG   Thermococcus sp. AM4: TAM4_90Help
Entry
TAM4_90           CDS       T01638                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tha  Thermococcus sp. AM4
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1267056..1268537)
Genome map
AA seq 493 aa AA seqDB search
MERYILSLDEGTTSARAIIFDRESNIIGLGQYEFPQHYPRPGWVEHNPEEIWDAQFRAIK
TALERAKIEPSQIAAIGVTNQRETTIVFDRDGKPLYNAIVWQCRRTAELIEEIKREYGDM
IKQKTGLVPDAYFSASKLKWLLDNVPGLREKAEKGEVLFGTVDTFLIYRLTGEHVTDYSN
ASRTMLFNIKRLDWDDELLEIFGIPEEVLPEVKESSEVYGYTKKELLGTEIPVSGDAGDQ
QAALFGQAGFETGMVKATYGTGSFILANTGKTVRYSDNLLTTIAWGLNGKVTYALEGSVF
VTGAAVQWLRDGIKIIKHASETEELARKLESNEGVYFVPAFVGLGAPYWDQFARGLIIGI
TRGTGREHLARATLEAIAYLTRDVIEEMEKLVGIKELRVDGGATANDFLMQFQADILNRR
VVRPVVKETTALGAAYLAGLAVDYWESLEEIESLWKAEKVFEPGMDEETRRKLYHGWKEA
VKRAMGWAKVVGV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctatatcctctcactcgacgagggaactacttccgcgagggcgataatcttc
gacagggagagcaacatcatcggcctcggtcagtacgagtttccccagcactatccgagg
cccggctgggtggagcacaatccggaggaaatctgggacgcgcagttcagggccataaag
actgcccttgagcgggcgaaaatagagccaagtcaaatagcggcgattggcgttactaac
caaagagaaactacgatagtctttgaccgcgacggaaaaccgctctacaacgcgatagtc
tggcagtgcaggagaacggccgagcttatcgaggagataaagcgcgaatacggggatatg
ataaagcagaagaccggcctcgtccccgacgcttacttctccgcgagcaagctcaagtgg
ctcctcgacaacgttccaggcttaagggagaaggcggagaagggcgaagtcctctttgga
accgtcgacactttcttaatctaccgcctcactggagagcacgtaaccgattactccaac
gcctcaaggacgatgctcttcaacataaagaggctcgactgggatgacgaactccttgaa
atcttcgggatcccggaggaggttctgccggaagtgaaggagtcgagcgaggtctacggc
tacacgaagaaggaactcctcgggacggagattccggtgagcggcgatgcaggagaccag
caggcggctctgttcgggcaggcgggcttcgagaccggaatggtgaaggccacctacgga
acgggaagcttcattttagcaaacaccggaaagaccgtccgctactccgataatctgctc
acgacaatagcctggggactcaacggaaaggttacctatgccctcgagggaagcgttttt
gtaacgggagcagcggttcagtggctccgcgacggaataaagattatcaagcacgcctcc
gaaaccgaggaactcgcgaggaagctcgagagcaacgaaggagtctacttcgtcccggct
ttcgtcggccttggagcaccgtactgggaccagttcgcacgggggctgataatcggtata
acgcgtggaaccggcagggagcacctcgcaagggcaactctggaggcgatagcctatctc
acgcgcgacgtcatagaggagatggagaagctcgtcgggataaaggagctccgcgttgac
ggcggggccacggcgaacgacttcctgatgcagttccaggcggacatactgaacaggcgc
gttgtcaggcccgtcgtcaaggaaaccaccgcgctcggcgcggcgtatctggccggactg
gccgtcgattactgggagagccttgaggagatagagagcctctggaaggcggagaaggtg
ttcgagccggggatggacgaggaaacaaggagaaagctctatcacggctggaaggaggcg
gtaaagagggccatgggctgggcgaaggtcgttggggtctga

DBGET integrated database retrieval system