KEGG   Candidatus Endolissoclinum faulkneri L2: A1OE_1420Help
Entry
A1OE_1420         CDS       T02365                                 

Definition
(GenBank) glutaredoxin family protein
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
thal  Candidatus Endolissoclinum faulkneri L2
Pathway
thal00230  Purine metabolism
thal00240  Pyrimidine metabolism
thal01100  Metabolic pathways
thal03030  DNA replication
thal03430  Mismatch repair
thal03440  Homologous recombination
Module
thal_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:thal00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    A1OE_1420
   00240 Pyrimidine metabolism
    A1OE_1420
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    A1OE_1420
   03430 Mismatch repair
    A1OE_1420
   03440 Homologous recombination
    A1OE_1420
Enzymes [BR:thal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     A1OE_1420
DNA replication proteins [BR:thal03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     A1OE_1420
DNA repair and recombination proteins [BR:thal03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     A1OE_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AFX99589
UniProt: K7YSQ8
Position
complement(1289978..1290469)
Genome map
AA seq 163 aa AA seqDB search
MYKCILQVFRSITNMTEIIFYHLTSITVNKALPKLLCKTLAARERAIVLLASAEKVQALD
YHLWVYDERSWLPHGAQKYDNANLQPIWLTHRNENPNGARFLFIIERVEAFDLSSFKRVF
DLFDGHNHKSIAAARLRWKLARDAGHVITYWRQKNNGSWLKIA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
ttgtataaatgcatactacaagtctttagatcgataaccaatatgactgaaattatattt
taccatctgacgtctataactgtgaataaagccttacctaaattgctgtgtaaaacttta
gcagcgagagaacgtgcaattgtacttctagcttcagccgaaaaagtacaagctcttgat
tatcatctttgggtatatgatgaaagatcttggctgcctcatggagcgcagaaatacgat
aatgctaatttgcaaccaatttggcttactcatcgaaatgagaatccaaatggagctagg
ttcttatttattattgaacgagtggaagcttttgacttgagcagttttaagcgagttttt
gatctgtttgatggtcataatcataagtcgattgctgctgcaagactacgttggaagtta
gcgcgtgatgctggacatgtaattacttactggcgtcaaaaaaataatggttcttggctc
aaaatagcttga

DBGET integrated database retrieval system