KEGG   Endolissoclinum patella: A1OE_1465Help
Entry
A1OE_1465         CDS       T02365                                 

Gene name
sucC
Definition
succinate-CoA ligase, subunit beta (EC:6.2.1.-)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
thal  Endolissoclinum patella
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:thal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A1OE_1465 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1OE_1465 (sucC)
   00640 Propanoate metabolism
    A1OE_1465 (sucC)
   00660 C5-Branched dibasic acid metabolism
    A1OE_1465 (sucC)
Enzymes [BR:thal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     A1OE_1465 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1342026..1343195
Genome map
AA seq 389 aa AA seqDB search
MNIHEYQAKALFVKHGIPVPKGGIAFTPEEAVRLAKDLDAQIYVIKAQIHAGGRGKGGGV
KVAKSIDEVRYEAEKMLNMNLITKQTKPEGQRVKCIYVEESSNIARELYISLLVDRATSR
IAVIASSEGGVDIEELAEKKPEKILTVSIDPAIGMAQHYARRIAFVLGFRGKQVNFMIEF
LARLYDFFTSFNVLLLEINPLIENIAGDIVALDAKIDFDDSALYRHQEIATMRDEDEEDP
IEVKANKYGLNYVKLNGSIGCMVNGAGLAMATMDIIKLYGGEPANFLDVGGGATKEQIAA
AFKLILSDKNVKGIMINIFGGIMRCDLIAEGIVTAARKINLHVPLVIRLDGTNVENGKQI
LSNSGMKIISADTLEEAASKIVKAVREFT
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagctaaggctctttttgttaaacatgggataccagtgcca
aaaggcggaatagccttcactccagaagaagctgttagattagctaaagatttggacgct
cagatttacgtgatcaaagctcagatccatgccggaggtcgcggtaagggaggtggagtt
aaagtagctaagtcaatcgatgaagttcgatacgaagctgagaaaatgctcaatatgaac
ctaatcacaaagcaaactaaaccagaaggtcaaagagtaaagtgtatatacgtcgaagaa
tcctcgaatattgctcgtgaactttacatctcacttttagttgatcgtgcaacatcacga
attgccgtgattgcttccagcgaaggtggtgtagatattgaagagcttgccgaaaaaaaa
ccagaaaaaattctgactgtctcaatagacccggcaattggtatggctcaacactacgca
cgacgtattgcatttgtgcttggctttcgaggcaagcaagtaaattttatgatagaattc
ttagctagattgtatgacttctttactagtttcaatgtattattgctggaaatcaatccg
ttgatcgagaatattgccggtgatatagtagctcttgatgcaaagattgactttgatgat
agcgctctctaccgtcaccaagagattgctacaatgcgcgatgaggacgaagaagatccg
atagaagtcaaggcgaataaatatggtttgaactatgtaaaactaaatggctcaattggt
tgcatggtcaacggtgctggtctagcgatggctaccatggatataataaagttatacggt
ggtgaaccagctaatttccttgatgttggtggtggtgcaacaaaagagcagattgcagca
gctttcaagcttatcctatcggataaaaatgtgaaaggtattatgatcaatatttttggt
ggtattatgcgctgcgatttaattgccgaaggcattgtcaccgcagcaagaaagatcaat
ctgcatgtgcctttagtaatacgccttgatggtaccaacgttgaaaatggcaagcaaata
ttgtcaaacagcggtatgaaaattatctccgccgatacgctagaagaagctgctagcaag
atagttaaagctgtgagggaattcacataa

DBGET integrated database retrieval system