KEGG   Candidatus Endolissoclinum faulkneri L2: A1OE_1468Help
Entry
A1OE_1468         CDS       T02365                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
thal  Candidatus Endolissoclinum faulkneri L2
Pathway
thal00020  Citrate cycle (TCA cycle)
thal00310  Lysine degradation
thal01100  Metabolic pathways
thal01110  Biosynthesis of secondary metabolites
thal01120  Microbial metabolism in diverse environments
thal01130  Biosynthesis of antibiotics
thal01200  Carbon metabolism
Module
thal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
thal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:thal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1OE_1468 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    A1OE_1468 (sucB)
Enzymes [BR:thal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     A1OE_1468 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3
Motif
Other DBs
NCBI-ProteinID: AFX99637
UniProt: K7YQ06
Position
1347295..1348527
Genome map
AA seq 410 aa AA seqDB search
MATEIKVPALGDYVSEATIAKWIKSPGDVVNADEPLLELETDKVTIEVNAPSNGILTNIS
AKIGDKVKVNAVLGMIEQNISHSIRKDELKQIVVQQKNDVPVLPSSLATNNFELKSMSPA
VRKLVEENNLDPTRITPTGKDGRLIRKDVLQAIAAGTAKRAFINSVSIAEQIPHRPENPR
EERVKMTRLRQVIANRLKEAQSTAATLTTFNEVDMTTVMNLRKQHKNSFEKKHGVRLGFM
SFFVKACVHALRQLPVLNAEIYYDEIIYKNFFDIGVAVGTATGLVVPILRDADQLSFATV
EKTIYELGVKARDGKLSINEMQGGTFTISNGGIYGSMMSTPILNPPQSGILGMHKIQPRP
IVIGNSVEIRQMMYLALSYDHRIVDGREAVTFLVKVKDAIEDPNQLLLDL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagagattaaggttccagcactcggggattatgtctctgaagcgacaattgca
aaatggattaagtcgcccggagatgtcgtcaacgccgatgagcctttattagagcttgaa
acggataaagttactatagaggttaatgcaccatcaaacggcatcctaacaaatattagc
gctaaaattggggacaaggtgaaggttaatgcggtgcttggcatgattgaacaaaatata
tcccattctatacgaaaagatgaattaaaacaaattgttgtacaacaaaaaaatgatgtt
ccggtactaccttcttctcttgctactaataattttgaattaaaaagtatgtctcctgcg
gtgcgtaaattagttgaagaaaacaatctagatccaacaaggattactcctactggcaaa
gatggccgattaattcggaaagatgtgctacaagcgattgctgcaggtacagcgaaacgt
gcatttatcaatagtgtatcaatagcagagcaaataccgcatcgtccggaaaatcctcgc
gaagaacgcgtgaaaatgacaagactccgtcaggttatagcaaatcgtttaaaggaagct
caaagtactgcagctacattaactacattcaatgaagttgatatgacgacagtaatgaat
ttgcgcaaacaacacaaaaatagcttcgagaagaagcatggtgtaagacttggctttatg
agctttttcgttaaagcttgcgttcatgccttacgccagcttcccgttcttaatgccgaa
atatattatgatgaaattatttataaaaacttttttgatataggtgttgctgttggtact
gctacaggtctggtagtgccaatattgcgtgatgctgatcaactttcttttgctactgtt
gaaaagactatatatgaacttggcgtaaaggcacgcgatggtaagctttctattaatgaa
atgcagggcggcacttttactatatctaacggtggcatatatgggtctatgatgtctact
ccgattcttaatccacctcaatccggtattcttggtatgcataaaatccagcccagacca
atagtgattggtaattctgttgaaatacgtcaaatgatgtatctagcactgagttacgat
cataggattgttgatggccgtgaagctgtcacttttctagttaaagtcaaggatgctatt
gaagatccaaaccagttattactagacttataa

DBGET integrated database retrieval system