KEGG   Endolissoclinum patella: A1OE_1540Help
Entry
A1OE_1540         CDS       T02365                                 

Definition
cytochrome c distal domain-containing protein
Orthology
K08738  
cytochrome c
Organism
thal  Endolissoclinum patella
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:thal00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    A1OE_1540
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A1OE_1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1472613..1473002)
Genome map
AA seq 129 aa AA seqDB search
MITINLLIRLPIIGCMLIFPSLAFAQDGDPVAGKNVFRKCQACHTVQQGQHRQGPSLYGV
IGRRAGTAEGYKRYSEAMKNYGIIWDANNLNIYLENPKKALPGNKMPFVGLKNIKDRQDV
ISYLQQVVK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgattacaattaatctacttatccgcctccctattataggatgtatgctaatttttcct
tccttagcattcgcccaagatggagatccggttgctggtaaaaatgtttttcgtaaatgt
caagcatgtcatacagtgcagcaaggtcaacaccgtcagggtccttctctttatggagtt
ataggacgacgtgcgggtactgctgagggctataaacgttattcagaagcaatgaaaaat
tatggaattatctgggacgcaaacaacttaaatatatatttggaaaatcctaaaaaagca
ttaccgggtaataaaatgccttttgttggtttgaaaaatatcaaagatcggcaggatgta
atatcttacttgcagcaagtagttaaatga

DBGET integrated database retrieval system