KEGG   Endolissoclinum patella: A1OE_309Help
Entry
A1OE_309          CDS       T02365                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
thal  Endolissoclinum patella
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:thal00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:thal00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
291648..292913
Genome map
AA seq 421 aa AA seqDB search
MHQIRVRGGRPLRGTIPISGAKNAALPLMAACLLSCKPLNLTNVPDVADIASMTNLLRQH
GVHIERDGGDMIMDAAQVESTTAPYNLVRKMRASVLVLGPLVARFGQAQVSLPGGCAIGN
RPIDLHLKGLADLGAELTIEAGYIEAKAPKGGLQCGRFTFPFVSVGATENLMMAASLAQG
ETVLINSAREPEISDLAKLLIAMGAEIEGAGTDTIYIQGKAELGGASHRVVADRIETGTY
AMAVAIVGSEVILTNTDLVLINSTAETLRQAGVTLEAVDGGVRVARGDERVLGVDMMTRP
YPGFPTDLQAQFMSLMSVSRGESIITETIFDNRFMHVQELSRMGANITVHEASAIIRGVE
KLKGAQVMATDLRASVSLVLAGLAAEGETIINRIYHLDRGYQDLIGKLSACGADVTKIVS
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagattcgtgtgcggggtgggagacctctccgcgggaccattcctataagcggc
gctaagaatgctgctttaccattgatggcagcgtgtttactgtcctgtaaaccgctgaat
ttaaccaatgttccagatgtggctgatattgcctcaatgactaatctgttgcgtcaacac
ggagtacacatagagcgagatggtggagatatgataatggatgcggctcaggtcgagagt
actaccgctccttataatttagtaagaaaaatgcgtgcttcggttctggtacttggacca
cttgtggcacgatttggacaggctcaagtatctttacctggtggttgtgcaataggtaat
cgtccaattgatttgcatttgaaaggtctagcagatcttggtgctgagttaaccattgaa
gctggttatatagaggccaaggcaccgaaaggtggtttgcaatgcggacgatttactttt
ccctttgtatcagttggtgcaactgagaaccttatgatggcagcatctttagcacaaggt
gagacagtgttaatcaattcagcacgagagccagaaatcagcgatttggctaagttactc
attgctatgggtgctgaaattgagggggctggtactgacaccatctatatccaaggtaaa
gcagaactaggtggcgctagccaccgagtagtcgcagatcgaatcgagacaggaacttat
gctatggcagtagccattgtaggtagtgaagtaatcctgaccaatactgatttagtgctg
attaactcgactgctgaaactttaagacaggcaggagtcactttagaggctgttgacggt
ggtgttcgtgttgctagaggtgatgaacgtgtacttggcgtcgatatgatgaccaggcca
tatcctggtttcccaactgatttgcaggcacagtttatgtcattgatgagcgtatctcga
ggtgagtctataatcactgagactatttttgataaccgctttatgcacgtacaagagttg
tcacgtatgggggctaatatcactgtgcacgaagcttcagctattatacgtggcgtagag
aaattgaaaggtgcgcaggttatggcaacggatctacgggcttctgtttctctagtgcta
gctgggttagctgccgaaggggagacaataattaaccgaatttatcatctagatcgcggc
tatcaagatttgattggtaagctatctgcctgcggtgcagatgtaactaaaatagtctct
gggtaa

DBGET integrated database retrieval system