KEGG   Candidatus Endolissoclinum faulkneri L2: A1OE_331Help
Entry
A1OE_331          CDS       T02365                                 

Definition
(GenBank) GHMP kinase C terminal family protein
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
thal  Candidatus Endolissoclinum faulkneri L2
Pathway
thal00900  Terpenoid backbone biosynthesis
thal01100  Metabolic pathways
thal01110  Biosynthesis of secondary metabolites
thal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:thal00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A1OE_331
Enzymes [BR:thal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     A1OE_331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFX98528
UniProt: K7Z3H7
Position
307925..308827
Genome map
AA seq 300 aa AA seqDB search
MNGSNNGVLSKVNACPRIRLSPAKVNLALHLIGRRSDGYHFIDTLVAFADFGDWVTWRTG
GSACLLEVKDCFNRSKPIPKNTANLAWQALSIAGRISNFLLSGSLTVEKFLPSGAGIGGG
SSNAATVMHLILEDVNINKDSLYTKALMLGSDVPVCLAGCPTRVEGVGERLTTITLAKPL
PVVMVWPGASLSTASVFRYGKFNDYGNIPARAIECLATDPLSAIASLRNDLECISCCLLP
AVRQAMFALQNCSGCRVARMSGSGSVVVGYFENYCSANAAAKMLTFYSPSWWVRACTLLI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaacggctctaacaatggtgtgctttctaaggttaatgcttgccctcgaattcgtctt
tcgccagcaaaagttaaccttgctttacatttgattggcagacgatcggatggatatcat
tttattgatacacttgtagcgtttgctgattttggtgactgggtgacttggcgaacaggc
ggatctgcttgtttattggaagtaaaagattgttttaatcgatctaaaccaatacccaaa
aacactgctaacttagcatggcaggctttgtcaattgcaggtaggattagcaatttttta
ctatctggatctttgaccgtggagaaatttttaccttcaggcgctggtataggtggtggg
tcaagcaatgctgctaccgttatgcatttaatacttgaggatgttaatataaacaaagat
agtttgtatactaaagccctaatgcttgggagtgatgtaccagtttgcctggctggctgt
cccactcgggtagagggggtaggtgagcggctaactacaattactttagccaaaccattg
ccagtagttatggtttggcctggagcaagcctttctactgcatctgtttttagatacgga
aagttcaatgattatggtaatataccagcaagagcaattgaatgtttagctactgatcct
ttaagtgctattgcaagtttacgtaatgacctagaatgtatatcttgttgtttgcttcct
gctgttaggcaagcgatgtttgcgctgcaaaattgcagcggttgccgtgtcgctcgaatg
tcagggagcggatctgttgtagtaggctacttcgaaaactactgtagtgccaatgctgct
gcaaaaatgctgacattttactcaccaagttggtgggtgcgtgcttgtaccttactaata
taa

DBGET integrated database retrieval system