KEGG   Endolissoclinum patella: A1OE_331Help
Entry
A1OE_331          CDS       T02365                                 

Definition
GHMP kinase C terminal family protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
thal  Endolissoclinum patella
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thal00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A1OE_331
Enzymes [BR:thal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     A1OE_331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
307925..308827
Genome map
AA seq 300 aa AA seqDB search
MNGSNNGVLSKVNACPRIRLSPAKVNLALHLIGRRSDGYHFIDTLVAFADFGDWVTWRTG
GSACLLEVKDCFNRSKPIPKNTANLAWQALSIAGRISNFLLSGSLTVEKFLPSGAGIGGG
SSNAATVMHLILEDVNINKDSLYTKALMLGSDVPVCLAGCPTRVEGVGERLTTITLAKPL
PVVMVWPGASLSTASVFRYGKFNDYGNIPARAIECLATDPLSAIASLRNDLECISCCLLP
AVRQAMFALQNCSGCRVARMSGSGSVVVGYFENYCSANAAAKMLTFYSPSWWVRACTLLI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaacggctctaacaatggtgtgctttctaaggttaatgcttgccctcgaattcgtctt
tcgccagcaaaagttaaccttgctttacatttgattggcagacgatcggatggatatcat
tttattgatacacttgtagcgtttgctgattttggtgactgggtgacttggcgaacaggc
ggatctgcttgtttattggaagtaaaagattgttttaatcgatctaaaccaatacccaaa
aacactgctaacttagcatggcaggctttgtcaattgcaggtaggattagcaatttttta
ctatctggatctttgaccgtggagaaatttttaccttcaggcgctggtataggtggtggg
tcaagcaatgctgctaccgttatgcatttaatacttgaggatgttaatataaacaaagat
agtttgtatactaaagccctaatgcttgggagtgatgtaccagtttgcctggctggctgt
cccactcgggtagagggggtaggtgagcggctaactacaattactttagccaaaccattg
ccagtagttatggtttggcctggagcaagcctttctactgcatctgtttttagatacgga
aagttcaatgattatggtaatataccagcaagagcaattgaatgtttagctactgatcct
ttaagtgctattgcaagtttacgtaatgacctagaatgtatatcttgttgtttgcttcct
gctgttaggcaagcgatgtttgcgctgcaaaattgcagcggttgccgtgtcgctcgaatg
tcagggagcggatctgttgtagtaggctacttcgaaaactactgtagtgccaatgctgct
gcaaaaatgctgacattttactcaccaagttggtgggtgcgtgcttgtaccttactaata
taa

DBGET integrated database retrieval system