KEGG   Candidatus Endolissoclinum faulkneri L2: A1OE_738Help
Entry
A1OE_738          CDS       T02365                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
thal  Candidatus Endolissoclinum faulkneri L2
Pathway
thal00020  Citrate cycle (TCA cycle)
thal00190  Oxidative phosphorylation
thal00650  Butanoate metabolism
thal01100  Metabolic pathways
thal01110  Biosynthesis of secondary metabolites
thal01120  Microbial metabolism in diverse environments
thal01130  Biosynthesis of antibiotics
thal01200  Carbon metabolism
Module
thal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
thal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
thal_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:thal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1OE_738 (sdhD)
   00650 Butanoate metabolism
    A1OE_738 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    A1OE_738 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFX98924
UniProt: K7YQX1
Position
complement(685184..685528)
Genome map
AA seq 114 aa AA seqDB search
MEYVKGGAHHWLVQRITAIILVPFVLWLVISVISLTKMDYATAREWIGSTSVSITLISLI
IASFYHAQLGLQVIVEDYVHSKSLRLAILLLIKFAILVVVISVIFAVLKIALGC
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggagtatgttaaaggtggcgcgcatcactggttagtgcaacgaattacagccataatc
ctagtcccatttgtcctatggttagtgatttctgtgataagtttgactaaaatggactac
gctaccgccagggaatggataggttctacttcagtatctataactttaatatctttgatc
attgcatcattttatcatgctcaacttggtctgcaagtgattgttgaggattatgtacac
agtaagagtttaaggcttgccatactgctcttgataaagtttgctatacttgttgtagtg
atttctgtaatatttgctgtattaaaaattgctttagggtgttag

DBGET integrated database retrieval system