KEGG   Endolissoclinum patella: A1OE_765Help
Entry
A1OE_765          CDS       T02365                                 

Gene name
dhfrIII
Definition
dihydrofolate reductase type 3 (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
thal  Endolissoclinum patella
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A1OE_765 (dhfrIII)
   00670 One carbon pool by folate
    A1OE_765 (dhfrIII)
Enzymes [BR:thal01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     A1OE_765 (dhfrIII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
707420..707881
Genome map
AA seq 153 aa AA seqDB search
MADNMVIGRNNGSLPWLIPKDLARFKHCTLGHSILMGRRTWDTIGHPLPFRRSIVFTRNV
HWAAKGAYPVKNLDAALAVCVKEKEVFVVGGRDIFALTIPLADALFLTFVHTQARGDVQF
PNINWSAWREIWRENHPPDGNRPAFTFTNYLRT
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaacatggtaatcggtcgcaataatggtagtttaccttggttaatacctaag
gaccttgctcgttttaaacattgtacactaggtcacagcatattgatggggcgacgtaca
tgggacacaatcggtcatcctctgccgtttcgtcgatcaatagtctttactcgtaatgtg
cactgggctgcaaaaggagcatatccggtaaagaatctagatgccgccctcgctgtctgt
gttaaagaaaaggaagtatttgtcgttggcggaagggatatcttcgccttaacgatacca
ttagctgatgctttatttcttacttttgtacatacacaggctcgcggtgacgttcaattt
ccaaatattaactggtctgcctggcgcgaaatctggagagaaaatcatccacctgatggt
aatcgacctgcttttacttttactaattacttgcgtacctag

DBGET integrated database retrieval system