KEGG   Endolissoclinum patella: A1OE_776Help
Entry
A1OE_776          CDS       T02365                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
thal  Endolissoclinum patella
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:thal03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
719104..720012
Genome map
AA seq 302 aa AA seqDB search
MKSRVPTIRSADLIVGGECCLGLLIIMPELPEVENVMRGLAQRLTGQRLVGIELRRSALR
WPIPKEIVEQLTGKRITGFRRRAKYIIINFSNNISWIIHLGISGRMLVFNGSKPLIDIHD
HVVCYTDSSLWIKFNDYRRFGMMDLSPTNEIYQHKLLKNIGPEPLDKGFSSRTLESVLSG
KHVPIKAALLNQKLVAGIGNIYACEALHRSGILPSHFAMNITKKRAKKLVFEIKSVLTEA
IAAGGTSIRDHRQVNNEPGFFQNALRVYNREGERCLSDGCYGTVKRVVQYGRSTFYCPQC
QS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcaagggtaccaactattagatcagctgatctaatagttggtggtgaatgttgc
ttaggactgttaattattatgcctgaattgcctgaagtagaaaatgtaatgcgtggactt
gcccagagattaacagggcaaagattggttgggattgaactacgtcggtcagcactacgt
tggccaataccaaaggagatagttgaacagctaactggtaaacgtatcactggctttcgc
cgtcgcgctaaatacatcattatcaattttagcaataatataagctggataattcatcta
ggcatttctggccggatgctggtattcaatggttcaaagcctttgattgacattcatgat
cacgtagtatgctatacagatagctcgctttggataaaatttaatgattatcgtcgcttt
ggtatgatggatctgtcgccaacaaatgaaatttatcagcacaaattgcttaaaaatatc
gggccagaacctttggataaaggattttctagtagaacactagaatctgtattatccggc
aaacatgtaccgattaaagcggctctgcttaatcaaaaattagtagccggaatcggcaat
atttatgcatgtgaagccttgcatcgttccggtatcttaccttcccattttgctatgaat
attaccaaaaaacgagcaaaaaaattggttttcgagataaaatcagtacttaccgaagcg
atagccgcaggcggaacaagtatacgagatcaccgtcaagtcaataatgaacctggattt
ttccaaaatgctctccgggtttataatcgtgaaggagaaagatgtttatctgatggatgt
tatggaacggtgaaacgcgtagttcaatacggaagatcgactttttattgtcctcaatgc
caaagctaa

DBGET integrated database retrieval system