KEGG   Endolissoclinum patella: A1OE_817Help
Entry
A1OE_817          CDS       T02365                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
thal  Endolissoclinum patella
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:thal00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
760694..761905
Genome map
AA seq 403 aa AA seqDB search
MDKRKERSKVVDKARSISILGSTGSIGTNTIDLISRMPEQFIVSALACKCNARLLAKQAK
MLQAAFVAIADKNAWPVLRDSLAGTGIEAAAGSEAVLEAARRPAEWIMCSIVGAAGLAPT
LEAIRRGCTVALANKEALVCAGSLFIREAMRTGCQILPVDSEHNAIFQLFDTQKRDKIEK
ITLTASGGPFRTLSRKEMAYKTPKQAAAHPIWSMGKKVSIDSATIMNKGLEIIEAHYLFA
MPEVQIDVLIHPESVVHSIVSYIDGSVIAQLSSPDMRIPIAYCLAWPQRMKTITKNLDLV
SIGQLNFFTLDNDRFPAINIAREALRTKGDAPCVMNAANEVAVEAFVAGRIGFNEIISVV
YETMQRCPTEDIDNLDSVFRANAKGCRIANDIISAFTGVQLRR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttggataagcggaaggagcgttctaaagtggtagataaagcacgctcgatcagtatactt
gggtctactgggtcgattggcaccaatacaatcgatttgattagtcgtatgcctgagcaa
tttatcgtatctgccttagcttgtaagtgcaatgctagattattagcaaaacaagcaaag
atgttgcaagctgcctttgtagctatcgcagacaagaatgcctggccagttttgcgtgac
tcgctagcaggaacaggaattgaggctgcagctggtagcgaagcagtgctggaagctgca
agacgtccagcggaatggattatgtgctctatcgtcggcgcagcaggcttagctccaact
ttagaagcaatacgtcgcggctgtacagtagcactagctaataaagaagcattagtttgt
gctggttcgctgtttattagagaggcaatgcgtacaggatgtcaaatcctaccggttgat
agcgagcacaacgccatttttcaactattcgatactcaaaaacgcgataaaatcgaaaag
atcactcttacagcctcaggtggcccgtttcgtacactttctcgtaaagaaatggcttac
aaaactccaaaacaagcagcagcacatcctatttggtctatgggaaagaaggtttctatc
gacagtgctacgattatgaataaaggcttggagattattgaggcgcattatttatttgct
atgccagaagtgcaaatagacgtgttaattcatcctgaatctgtggtgcactcaatagtt
tcctacattgatggatcagtcatcgcacaacttagctctccagatatgcgtatacctatt
gcgtattgcttagcttggccgcaaagaatgaaaacaataacgaaaaatttagatttagtg
tcgattggtcagcttaacttctttacccttgataatgatagatttccagccataaatatt
gcacgagaagctttacgaacaaagggagatgcaccctgtgtaatgaatgcagctaacgaa
gtagccgttgaggcgtttgtggcaggacggattggttttaacgagattatctcggtagtg
tatgaaacaatgcagcgttgtcctacagaagatatcgataaccttgactcagtctttagg
gcaaatgctaaagggtgtcgtattgcaaacgatataatatcagcttttacaggtgttcaa
ttgcgaagatag

DBGET integrated database retrieval system