KEGG   Thermofilum sp. 1910b: N186_00120Help
Entry
N186_00120        CDS       T02802                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
thb  Thermofilum sp. 1910b
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:thb00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(20238..20891)
Genome map
AA seq 217 aa AA seqDB search
MAYEDLKREIVEAFVFLEEHGMNWAYSGNISVRVGEDLFLLSPSGVWKARMKPEDVLLVT
GDGKVLEGNGKPSVEFKTHVAIYRARRDVKAVVHAHPIYAGIIAAKRVDIEPVLEELTFY
VGGTIRVASYAPSGTEELARNAVEALGDKKAVILANHGVVACGSSLEEALAVLGYVERAA
KVAVYSMLIGGVHPLPREAETLERELYVQKLHRAMSQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaggatctcaagagggagattgtcgaggcgtttgttttcctcgaagagcat
gggatgaactgggcctacagcgggaacatcagcgtaagggtgggcgaagaccttttcctt
ctttctcctagcggtgtctggaaggcgaggatgaagccggaagacgttctcctcgttact
ggagacggaaaagtgctggagggtaacgggaagccgtctgtagagttcaagacccacgtt
gctatctatagggctaggagggacgtaaaagccgttgtccacgctcacccaatatatgcc
gggataatagcggcgaagcgtgtagacatagagcccgtcctcgaggagctgaccttctat
gttggtgggacgataagggtggcaagctacgcgccgtcgggtacagaggagttggctagg
aacgctgtggaggcgctcggagacaagaaggcagtcatacttgccaaccacggcgtagtc
gcgtgtggctcaagcctcgaagaggctctagccgttttgggctacgtggagcgggcggca
aaggtggcagtatactctatgcttataggcggggtccacccgttgccccgagaagccgaa
acacttgaacgagagctctacgtacaaaaactgcatagagccatgtcccaataa

DBGET integrated database retrieval system