KEGG   Thermofilum adornatus: N186_00120Help
Entry
N186_00120        CDS       T02802                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
thb  Thermofilum adornatus
Pathway
thb00051  Fructose and mannose metabolism
thb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:thb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    N186_00120
Enzymes [BR:thb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     N186_00120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AGT34422
UniProt: S6A4S1
Position
complement(20238..20891)
Genome map
AA seq 217 aa AA seqDB search
MAYEDLKREIVEAFVFLEEHGMNWAYSGNISVRVGEDLFLLSPSGVWKARMKPEDVLLVT
GDGKVLEGNGKPSVEFKTHVAIYRARRDVKAVVHAHPIYAGIIAAKRVDIEPVLEELTFY
VGGTIRVASYAPSGTEELARNAVEALGDKKAVILANHGVVACGSSLEEALAVLGYVERAA
KVAVYSMLIGGVHPLPREAETLERELYVQKLHRAMSQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaggatctcaagagggagattgtcgaggcgtttgttttcctcgaagagcat
gggatgaactgggcctacagcgggaacatcagcgtaagggtgggcgaagaccttttcctt
ctttctcctagcggtgtctggaaggcgaggatgaagccggaagacgttctcctcgttact
ggagacggaaaagtgctggagggtaacgggaagccgtctgtagagttcaagacccacgtt
gctatctatagggctaggagggacgtaaaagccgttgtccacgctcacccaatatatgcc
gggataatagcggcgaagcgtgtagacatagagcccgtcctcgaggagctgaccttctat
gttggtgggacgataagggtggcaagctacgcgccgtcgggtacagaggagttggctagg
aacgctgtggaggcgctcggagacaagaaggcagtcatacttgccaaccacggcgtagtc
gcgtgtggctcaagcctcgaagaggctctagccgttttgggctacgtggagcgggcggca
aaggtggcagtatactctatgcttataggcggggtccacccgttgccccgagaagccgaa
acacttgaacgagagctctacgtacaaaaactgcatagagccatgtcccaataa

DBGET integrated database retrieval system