KEGG   Thermofilum sp. 1910b: N186_00120Help
Entry
N186_00120        CDS       T02802                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
thb  Thermofilum sp. 1910b
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:thb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    N186_00120
Enzymes [BR:thb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     N186_00120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(20238..20891)
Genome map
AA seq 217 aa AA seqDB search
MAYEDLKREIVEAFVFLEEHGMNWAYSGNISVRVGEDLFLLSPSGVWKARMKPEDVLLVT
GDGKVLEGNGKPSVEFKTHVAIYRARRDVKAVVHAHPIYAGIIAAKRVDIEPVLEELTFY
VGGTIRVASYAPSGTEELARNAVEALGDKKAVILANHGVVACGSSLEEALAVLGYVERAA
KVAVYSMLIGGVHPLPREAETLERELYVQKLHRAMSQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaggatctcaagagggagattgtcgaggcgtttgttttcctcgaagagcat
gggatgaactgggcctacagcgggaacatcagcgtaagggtgggcgaagaccttttcctt
ctttctcctagcggtgtctggaaggcgaggatgaagccggaagacgttctcctcgttact
ggagacggaaaagtgctggagggtaacgggaagccgtctgtagagttcaagacccacgtt
gctatctatagggctaggagggacgtaaaagccgttgtccacgctcacccaatatatgcc
gggataatagcggcgaagcgtgtagacatagagcccgtcctcgaggagctgaccttctat
gttggtgggacgataagggtggcaagctacgcgccgtcgggtacagaggagttggctagg
aacgctgtggaggcgctcggagacaagaaggcagtcatacttgccaaccacggcgtagtc
gcgtgtggctcaagcctcgaagaggctctagccgttttgggctacgtggagcgggcggca
aaggtggcagtatactctatgcttataggcggggtccacccgttgccccgagaagccgaa
acacttgaacgagagctctacgtacaaaaactgcatagagccatgtcccaataa

DBGET integrated database retrieval system