KEGG   Thermofilum sp. 1910b: N186_00835Help
Entry
N186_00835        CDS       T02802                                 

Definition
(GenBank) peptidase M28
Organism
thb  Thermofilum sp. 1910b
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(158254..159351)
Genome map
AA seq 365 aa AA seqDB search
MSNYKITEKELQFLKDVTEIVAPSGFEEPVMELIKQHYSRYADSVKRDNLGSLMLVKKGS
SDTPKILVAGHVDEVGFLVTSITQEGFLTFVPLGGWFEQVLLAQRVVIRTKNGPVYGVIT
SKPPHLLTPEERQKVVQINQMYIDVGATSKEEVEKLGIRVGDPVAPWSPFMKTAFPDRIM
AKALDDRIGAFIALEALRYIRENNIEHRNTLYAAATVQEEVGLRGAETVGWIADHDVAIV
TEVDIAGDVPGIKPSEAQAKVGKGPTIVVWDRSMIPNPRFKEFVIEVAEEAKIPYQLSAV
SGGTDAGRLHLYKGGRPSIVIGVPTRHIHSHVSIVSISDVENAVRLVVELVKRLDAETVK
KFTNI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaactacaaaataacagaaaaagagcttcaattcttaaaagatgtaacagaaatt
gttgccccatccggctttgaagaaccagtaatggaattaataaagcaacactattcgagg
tacgccgactcagtaaaaagggacaaccttggctcactcatgcttgtaaagaaaggttcc
tcggacaccccaaaaatactagtagccgggcacgtcgacgaggtcggcttcctggttaca
agcataacccaggagggttttctcacatttgtgcctctaggaggatggttcgagcaagtc
cttcttgcacagcgtgtagttattagaaccaagaatgggccagtatatggcgttattact
agcaagcccccgcacttgcttactccggaagagagacaaaaagtcgtccagataaaccag
atgtacattgatgtaggcgctacaagcaaagaggaggttgaaaaactaggcataagggtt
ggcgaccccgtcgctccctggtcccccttcatgaagaccgccttcccagacagaataatg
gctaaggccctagacgacaggataggagcatttattgcgctagaagcactcagatacatc
agggaaaacaatatagagcacagaaacacgctctacgcggctgcaaccgtgcaagaagag
gtaggtctaagaggagccgagacagttggctggatagctgaccacgacgtagcaattgta
acagaagtagacattgctggagatgttcctgggataaagccgagcgaggcccaggcaaag
gtaggcaaggggcccacaatagttgtatgggatagatcaatgattccaaacccaagattc
aaggagtttgtcatcgaggtggctgaagaggcaaagattccatatcagctgtcggctgtc
agtggtgggacggatgccggcaggttgcacctctacaaggggggaaggccaagcatagtt
ataggggttccgactagacacatacacagccatgtaagcattgtgagtattagcgatgtt
gaaaacgctgtacgcctcgtagtcgagcttgtaaagaggcttgacgcagagacagttaaa
aaattcactaatatctaa

DBGET integrated database retrieval system