KEGG   Thermofilum sp. 1910b: N186_00835Help
Entry
N186_00835        CDS       T02802                                 

Definition
peptidase M28
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
thb  Thermofilum sp. 1910b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N186_00835
Enzymes [BR:thb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     N186_00835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(158254..159351)
Genome map
AA seq 365 aa AA seqDB search
MSNYKITEKELQFLKDVTEIVAPSGFEEPVMELIKQHYSRYADSVKRDNLGSLMLVKKGS
SDTPKILVAGHVDEVGFLVTSITQEGFLTFVPLGGWFEQVLLAQRVVIRTKNGPVYGVIT
SKPPHLLTPEERQKVVQINQMYIDVGATSKEEVEKLGIRVGDPVAPWSPFMKTAFPDRIM
AKALDDRIGAFIALEALRYIRENNIEHRNTLYAAATVQEEVGLRGAETVGWIADHDVAIV
TEVDIAGDVPGIKPSEAQAKVGKGPTIVVWDRSMIPNPRFKEFVIEVAEEAKIPYQLSAV
SGGTDAGRLHLYKGGRPSIVIGVPTRHIHSHVSIVSISDVENAVRLVVELVKRLDAETVK
KFTNI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaactacaaaataacagaaaaagagcttcaattcttaaaagatgtaacagaaatt
gttgccccatccggctttgaagaaccagtaatggaattaataaagcaacactattcgagg
tacgccgactcagtaaaaagggacaaccttggctcactcatgcttgtaaagaaaggttcc
tcggacaccccaaaaatactagtagccgggcacgtcgacgaggtcggcttcctggttaca
agcataacccaggagggttttctcacatttgtgcctctaggaggatggttcgagcaagtc
cttcttgcacagcgtgtagttattagaaccaagaatgggccagtatatggcgttattact
agcaagcccccgcacttgcttactccggaagagagacaaaaagtcgtccagataaaccag
atgtacattgatgtaggcgctacaagcaaagaggaggttgaaaaactaggcataagggtt
ggcgaccccgtcgctccctggtcccccttcatgaagaccgccttcccagacagaataatg
gctaaggccctagacgacaggataggagcatttattgcgctagaagcactcagatacatc
agggaaaacaatatagagcacagaaacacgctctacgcggctgcaaccgtgcaagaagag
gtaggtctaagaggagccgagacagttggctggatagctgaccacgacgtagcaattgta
acagaagtagacattgctggagatgttcctgggataaagccgagcgaggcccaggcaaag
gtaggcaaggggcccacaatagttgtatgggatagatcaatgattccaaacccaagattc
aaggagtttgtcatcgaggtggctgaagaggcaaagattccatatcagctgtcggctgtc
agtggtgggacggatgccggcaggttgcacctctacaaggggggaaggccaagcatagtt
ataggggttccgactagacacatacacagccatgtaagcattgtgagtattagcgatgtt
gaaaacgctgtacgcctcgtagtcgagcttgtaaagaggcttgacgcagagacagttaaa
aaattcactaatatctaa

DBGET integrated database retrieval system