KEGG   Thermofilum sp. 1910b: N186_01385Help
Entry
N186_01385        CDS       T02802                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
thb  Thermofilum sp. 1910b
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    N186_01385
Enzymes [BR:thb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     N186_01385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(240201..241736)
Genome map
AA seq 511 aa AA seqDB search
MKLKTRLLPFESANFTVILDHNVAKKLDVKLGDRVIVRFNGRSLTAIVNTAKDFPIDSIG
IYTNLARVLGISEGDEVEVEATSPPLSLQIIRKKLQGLKLESDEIYLLVKDIVEGKLSEL
ELAAFVTAVHFQGMVPSEIYDFTISMVNTGQTLNLKKKPILDKHSLGGVPGDKTSLLVVP
IIASLGYTIPKTSSRAITSAAGTADRMEVLAPVTFSIEEIEEIIHKTNGCIVWGGSLNLA
PADDIIIRVEYPLGIDPFFIPSILAKKLAVGSTHIVLDIPTGRGTKVKTLEEARRISQSF
HEIAKMLNMNLQTVATYAEEPIGHAIGPALEAREALQALKTLNPPDLVDKAASLAGTLLE
MVGEKDGYEMAIEALKSGKAEKKLREIIEAQGGDPNIQPEDITLGDKTYTLHANDSGFVY
YIDNSFLATLGKTAGAPIDKGAGVYIHVKLGEKVKKGQPLITIYSSSSAKLQLVEKLIEE
NTPILVGRTAGRRMLLEKIQYQPTRLVPLER
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaaactcgcttgcttccatttgaatcggcgaattttactgttatacttgac
cataatgtagcaaagaagcttgacgtcaagctaggggatcgcgtaattgtcaggtttaac
gggcgttcattaacagcgatcgtcaatacggcaaaggatttcccaatcgactccatagga
atttatacaaacctggcgagggtcttaggcatatccgaaggagacgaagtcgaggtagag
gcaacaagcccaccactttccctccagataataaggaaaaaactccaaggcctaaaactt
gagtctgacgaaatctatctcctggttaaagatattgtcgagggaaaactaagcgagcta
gaactagcggcattcgttacagcagttcacttccagggaatggttccctccgagatctat
gacttcacaatctccatggtaaatacggggcaaacactaaaccttaaaaagaagccaata
cttgacaagcatagtttgggaggagtgccaggagacaagaccagtcttttagttgttcca
ataattgcctctctaggatacaccataccaaaaacttcctcaagggcaataacctcggca
gctggaacagcagacaggatggaggttttagcaccagtgaccttctcgatagaggaaatc
gaggaaataatacacaaaactaacgggtgcatcgtgtggggtggttctctgaatctggcg
ccagcagacgacatcataataagggttgaataccctttgggaatagaccccttctttata
ccatccatccttgcaaaaaagctagccgtcgggtctacacacattgttttagacatccct
actgggagaggaacaaaggtaaagacactcgaggaggcacgaagaatctcacaaagcttc
cacgagatagcgaaaatgctaaacatgaatctccagacagtggccacatatgcagaggaa
cccattgggcatgcgataggaccagccttggaggcaagagaagcacttcaagcattaaaa
actcttaaccctccagatcttgtagacaaagctgcaagccttgcaggcacactcttggaa
atggttggcgaaaaagacggctacgagatggcgatagaggctttgaagagtggaaaagct
gaaaagaagcttcgcgaaatcatcgaggcacaaggaggggatccaaacatacagccagaa
gacataactctcggcgacaagacatataccttgcatgcaaacgactcgggcttcgtctac
tatattgacaactctttccttgcaacccttggcaaaacagctggagcgccgatagacaaa
ggggcaggagtatatattcacgtaaaactcggagagaaggtcaagaaaggacaaccactt
ataactatctattcatcgagcagtgcaaagctacaactcgtcgagaagctcatagaagaa
aacacacccatcctcgtgggtagaacagctggaagaagaatgctattagagaaaatacaa
taccagccaaccagactagtgcccctcgaaagataa

DBGET integrated database retrieval system