KEGG   Thermofilum adornatus: N186_01810Help
Entry
N186_01810        CDS       T02802                                 

Definition
(GenBank) hypothetical protein
Organism
thb  Thermofilum adornatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
317747..318766
Genome map
AA seq 339 aa AA seqDB search
MIDTGLLSSLANALAPSGFEKNVREIIAERLTELGYEPVTDNIGNVYVVLGEERPSLLLA
AHMDEVGLLTSFITDNGFLRVTPLGGVTPEGLPGQVVEVLTARGTVEGVIGSTPPHLRTG
PSKELSIDDLYVDIGVSTRKEAEERGVEVGTPISFQGNFRDLGDIIISKALDDRVGCYAL
LKALEEGAKPRRGSVIVAFTVQEELGLRGASVLAKELEPNYAVAVEGTLANDVPGVPPEK
YVTRLGAGPAIRIMDRSMVAGVEFFRHIRTLAEQNSLPYQLQISPYSGTDAGSFLVHGAT
VSAVSVPVRYIHSPASLASKRDIENTTKLLQLLIEDPFP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgatagacacaggcctgctttcaagtttagccaatgctcttgcaccttcgggcttcgag
aagaacgttcgggaaatcatcgccgagaggctcaccgagctcggctatgagcctgttaca
gataatattggaaacgtgtacgtcgtgttgggcgaggaaaggccaagccttctgcttgcg
gcacacatggacgaggttggacttttgacgtcttttattacagataatggtttccttagg
gtcacgcctctaggcggggttactccagaggggcttccgggacaggtcgtggaagtgtta
acagcgaggggcaccgtagagggcgtgatagggagtactcctccgcatctaaggacgggg
ccctcgaaggagctctcaattgatgacctatatgttgatataggtgtttccacgaggaag
gaggcagaagaaaggggcgtcgaggtagggacacctataagtttccagggaaactttaga
gacctcggagacatcataataagcaaggccctagacgacagggttggatgctacgcgttg
ctaaaggcactggaagagggggccaagcctagaaggggcagcgtcattgtagccttcacg
gtccaggaggagctggggctgaggggggcatctgtccttgcaaaagaacttgagcccaac
tatgctgttgctgttgaaggtactcttgcaaacgacgtgccaggcgtgccgcccgaaaaa
tacgttactaggctgggtgctggcccagctatcagaattatggataggagtatggttgct
ggtgtagagttcttccgtcatatcaggacgctcgcggagcagaactctttgccgtaccag
ctacagatatctccatacagcgggaccgatgccggaagcttcctggttcacggtgcgact
gtctctgcagtctccgtaccagtcaggtatatccactcgccagcgtctctagccagcaag
agggacatcgaaaacacgactaagcttttgcaactattgatagaagacccgttcccgtga

DBGET integrated database retrieval system