KEGG   Thermofilum sp. 1910b: N186_05130Help
Entry
N186_05130        CDS       T02802                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
thb  Thermofilum sp. 1910b
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:thb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    N186_05130
Enzymes [BR:thb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     N186_05130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
906735..907643
Genome map
AA seq 302 aa AA seqDB search
MTLKFAVSGNANIDIYYFVEKIPQPDEAVEALEIRTSLGGAATNIATGISKLGHYARFIG
FVGSDPEATEVLSELKQRGIDVAYVKSSSKQTGRVIVLLDKEGRRAMIAHRGANSELRPG
AFNPEETLRGIDHLHLSSTSPEYSYWFFREAKKMGISTSWDPGMTICLRGFKSIKNVLQY
VDVLFLNERENEALKIDPASIEKPLIIIKKGSEGSEAPQYKIKAEAFRVKALDATGAGDA
FDAAFLVAWKRKIGLKESLVIANAAGAIKVTRFGAHSSPTASELAEFLEKNGREDLARLF
KP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgactctaaaattcgctgtttcaggcaatgcaaacatagacatatactactttgtcgaa
aaaataccacagccagacgaagcagtggaagcactggagatcaggacatccctaggagga
gcggcaacaaacattgctacaggcatatctaaacttggtcactacgcgagatttattgga
tttgtgggaagcgacccagaggccacagaagttttatccgagcttaaacaacgaggaata
gacgtagcctacgtaaagtcttcgagcaaacagactggacgcgtaattgtcctcctcgac
aaagaaggtagaagagcaatgatcgcacatagaggcgccaacagcgagcttagaccagga
gcctttaacccagaagaaaccctcagaggcattgaccacctgcatctaagtagcacgagc
ccggaatactcatattggtttttcagggaggcgaagaagatgggcatttcgacaagctgg
gatccaggcatgaccatctgtctgagggggttcaaaagcatcaagaatgttctgcaatac
gtggacgtcctgtttttgaatgaacgcgagaatgaagcccttaaaatcgacccggcaagc
attgagaagcccttgattattatcaagaaaggaagtgaaggctctgaggcgccccagtat
aagataaaggctgaagcattcagagttaaagccttagacgctactggtgcaggcgatgct
tttgacgcggcttttctcgttgcttggaaaaggaaaataggtctaaaagaatcccttgtt
atagccaatgctgccggagcaataaaggttacaaggtttggtgcgcactcgtctcccact
gctagcgaactcgcagaattcctcgaaaaaaatggaagagaagatctagcaaggcttttt
aaaccttaa

DBGET integrated database retrieval system