KEGG   Thermofilum sp. 1910b: N186_06045Help
Entry
N186_06045        CDS       T02802                                 

Definition
glutamate dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
thb  Thermofilum sp. 1910b
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thb00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    N186_06045
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N186_06045
   00330 Arginine and proline metabolism
    N186_06045
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    N186_06045
Enzymes [BR:thb01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     N186_06045
Exosome [BR:thb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   N186_06045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1070406..1071740
Genome map
AA seq 444 aa AA seqDB search
MQIRTMVYKSFMLKYYFALFINGEKMTYENDPVYQMAVQQLKQSAKILNLPDDVVEVLRH
PERLLHVKIPVKLDNGKIAVFHGWRSQHNSALGPYKGGIRYHENVTEGEVVALSMWMTWK
NSLAGIPYGGGKGGVKVNPKELSPRELEELSRKYFAALSRIVGEDVDIPAPDVYTNPQTM
AWYMDEYSKIVGYNAWGVVTAKPKEIGGLYARVVSTGLGVAIVAREAAKKVWGGVENKTV
AVQGFGNVGIYAAKYLSEWGAKVVAVTDSKGGIYNPNGINVEELIKIKEQTGSVTNYKDY
KKKITNEEILELDVDILVPAAVENVITKDNAPRIKAKIISEGANGPTTPEADEILRKKDA
IVIPDILANAGGVVMSWIEWANNRMGNWLTEEEALSRLEKKMVENFGSVYNEWQKRFHEY
PMRIAAYAIAVERVVTAMKLRGWI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaggacaatggtctataaaagctttatgcttaaatattactttgcactattt
attaacggcgagaaaatgacatacgaaaacgaccctgtataccaaatggctgtacaacag
ctgaagcaaagcgccaagatcctcaacctaccggacgatgttgtcgaggttcttaggcac
ccagaaaggttattacacgtaaagataccagtaaaactagacaacggtaaaatagctgta
ttccacggctggagaagccagcacaacagtgctttagggccctacaaaggtggaataagg
taccacgagaacgttacagaaggcgaggttgtcgcgttgtcaatgtggatgacgtggaag
aactctcttgcaggcataccttacggtggtggcaagggaggagtaaaggttaatccaaag
gagctttccccaagagaactcgaagagctttctcgaaagtatttcgcggccttgtcgagg
attgttggagaagacgtggatataccagcaccagatgtgtacacgaatccacaaaccatg
gcatggtacatggacgagtacagcaagatagtcggctacaatgcgtggggagtggtgaca
gccaagccaaaggaaatcggtggactatacgcaagagtcgtaagcacagggctaggcgtc
gcaatcgttgctagagaagcggctaaaaaggtctggggaggcgtagaaaacaaaactgta
gctgtccaaggtttcggaaacgtaggaatctatgctgcaaaatacctcagtgaatgggga
gcaaaggttgtagcagtcacagacagtaagggtggcatatacaaccccaacggaataaac
gttgaagaacttatcaagatcaaggagcaaacaggtagcgtcacaaactacaaggactac
aagaaaaagattaccaatgaagaaatactcgagctggacgtagacatacttgtcccagca
gccgtcgaaaacgtcataacaaaggacaatgcacccagaataaaagccaaaatcataagc
gaaggcgcaaatggtccaacaacccccgaggcagacgagatactaaggaagaaagacgca
atcgtaatcccagatatccttgcaaacgctggaggcgtagtcatgtcctggatagagtgg
gcaaacaacaggatgggcaactggctcactgaggaagaggcgctttcaaggctagaaaag
aaaatggtcgagaacttcggtagcgtctacaacgagtggcagaaaagattccacgagtat
ccaatgagaattgcggcatatgcgatcgcagtagaaagagtagtaacggcaatgaagctc
aggggctggatctaa

DBGET integrated database retrieval system