KEGG   Thermofilum adornatus: N186_06045Help
Entry
N186_06045        CDS       T02802                                 

Definition
(GenBank) glutamate dehydrogenase
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
thb  Thermofilum adornatus
Pathway
thb00220  Arginine biosynthesis
thb00250  Alanine, aspartate and glutamate metabolism
thb00910  Nitrogen metabolism
thb01100  Metabolic pathways
thb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thb00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    N186_06045
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N186_06045
   00220 Arginine biosynthesis
    N186_06045
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    N186_06045
Enzymes [BR:thb01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     N186_06045
Exosome [BR:thb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   N186_06045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 2-Hacid_dh_C TRCF NAD_binding_7 ThiF
Motif
Other DBs
NCBI-ProteinID: AGT35548
UniProt: S5ZEM5
Position
1070406..1071740
Genome map
AA seq 444 aa AA seqDB search
MQIRTMVYKSFMLKYYFALFINGEKMTYENDPVYQMAVQQLKQSAKILNLPDDVVEVLRH
PERLLHVKIPVKLDNGKIAVFHGWRSQHNSALGPYKGGIRYHENVTEGEVVALSMWMTWK
NSLAGIPYGGGKGGVKVNPKELSPRELEELSRKYFAALSRIVGEDVDIPAPDVYTNPQTM
AWYMDEYSKIVGYNAWGVVTAKPKEIGGLYARVVSTGLGVAIVAREAAKKVWGGVENKTV
AVQGFGNVGIYAAKYLSEWGAKVVAVTDSKGGIYNPNGINVEELIKIKEQTGSVTNYKDY
KKKITNEEILELDVDILVPAAVENVITKDNAPRIKAKIISEGANGPTTPEADEILRKKDA
IVIPDILANAGGVVMSWIEWANNRMGNWLTEEEALSRLEKKMVENFGSVYNEWQKRFHEY
PMRIAAYAIAVERVVTAMKLRGWI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaggacaatggtctataaaagctttatgcttaaatattactttgcactattt
attaacggcgagaaaatgacatacgaaaacgaccctgtataccaaatggctgtacaacag
ctgaagcaaagcgccaagatcctcaacctaccggacgatgttgtcgaggttcttaggcac
ccagaaaggttattacacgtaaagataccagtaaaactagacaacggtaaaatagctgta
ttccacggctggagaagccagcacaacagtgctttagggccctacaaaggtggaataagg
taccacgagaacgttacagaaggcgaggttgtcgcgttgtcaatgtggatgacgtggaag
aactctcttgcaggcataccttacggtggtggcaagggaggagtaaaggttaatccaaag
gagctttccccaagagaactcgaagagctttctcgaaagtatttcgcggccttgtcgagg
attgttggagaagacgtggatataccagcaccagatgtgtacacgaatccacaaaccatg
gcatggtacatggacgagtacagcaagatagtcggctacaatgcgtggggagtggtgaca
gccaagccaaaggaaatcggtggactatacgcaagagtcgtaagcacagggctaggcgtc
gcaatcgttgctagagaagcggctaaaaaggtctggggaggcgtagaaaacaaaactgta
gctgtccaaggtttcggaaacgtaggaatctatgctgcaaaatacctcagtgaatgggga
gcaaaggttgtagcagtcacagacagtaagggtggcatatacaaccccaacggaataaac
gttgaagaacttatcaagatcaaggagcaaacaggtagcgtcacaaactacaaggactac
aagaaaaagattaccaatgaagaaatactcgagctggacgtagacatacttgtcccagca
gccgtcgaaaacgtcataacaaaggacaatgcacccagaataaaagccaaaatcataagc
gaaggcgcaaatggtccaacaacccccgaggcagacgagatactaaggaagaaagacgca
atcgtaatcccagatatccttgcaaacgctggaggcgtagtcatgtcctggatagagtgg
gcaaacaacaggatgggcaactggctcactgaggaagaggcgctttcaaggctagaaaag
aaaatggtcgagaacttcggtagcgtctacaacgagtggcagaaaagattccacgagtat
ccaatgagaattgcggcatatgcgatcgcagtagaaagagtagtaacggcaatgaagctc
aggggctggatctaa

DBGET integrated database retrieval system