KEGG   Thermofilum sp. 1910b: N186_06045Help
Entry
N186_06045        CDS       T02802                                 

Definition
glutamate dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
thb  Thermofilum sp. 1910b
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:thb00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:thb00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:thb00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1070406..1071740
Genome map
AA seq 444 aa AA seqDB search
MQIRTMVYKSFMLKYYFALFINGEKMTYENDPVYQMAVQQLKQSAKILNLPDDVVEVLRH
PERLLHVKIPVKLDNGKIAVFHGWRSQHNSALGPYKGGIRYHENVTEGEVVALSMWMTWK
NSLAGIPYGGGKGGVKVNPKELSPRELEELSRKYFAALSRIVGEDVDIPAPDVYTNPQTM
AWYMDEYSKIVGYNAWGVVTAKPKEIGGLYARVVSTGLGVAIVAREAAKKVWGGVENKTV
AVQGFGNVGIYAAKYLSEWGAKVVAVTDSKGGIYNPNGINVEELIKIKEQTGSVTNYKDY
KKKITNEEILELDVDILVPAAVENVITKDNAPRIKAKIISEGANGPTTPEADEILRKKDA
IVIPDILANAGGVVMSWIEWANNRMGNWLTEEEALSRLEKKMVENFGSVYNEWQKRFHEY
PMRIAAYAIAVERVVTAMKLRGWI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaggacaatggtctataaaagctttatgcttaaatattactttgcactattt
attaacggcgagaaaatgacatacgaaaacgaccctgtataccaaatggctgtacaacag
ctgaagcaaagcgccaagatcctcaacctaccggacgatgttgtcgaggttcttaggcac
ccagaaaggttattacacgtaaagataccagtaaaactagacaacggtaaaatagctgta
ttccacggctggagaagccagcacaacagtgctttagggccctacaaaggtggaataagg
taccacgagaacgttacagaaggcgaggttgtcgcgttgtcaatgtggatgacgtggaag
aactctcttgcaggcataccttacggtggtggcaagggaggagtaaaggttaatccaaag
gagctttccccaagagaactcgaagagctttctcgaaagtatttcgcggccttgtcgagg
attgttggagaagacgtggatataccagcaccagatgtgtacacgaatccacaaaccatg
gcatggtacatggacgagtacagcaagatagtcggctacaatgcgtggggagtggtgaca
gccaagccaaaggaaatcggtggactatacgcaagagtcgtaagcacagggctaggcgtc
gcaatcgttgctagagaagcggctaaaaaggtctggggaggcgtagaaaacaaaactgta
gctgtccaaggtttcggaaacgtaggaatctatgctgcaaaatacctcagtgaatgggga
gcaaaggttgtagcagtcacagacagtaagggtggcatatacaaccccaacggaataaac
gttgaagaacttatcaagatcaaggagcaaacaggtagcgtcacaaactacaaggactac
aagaaaaagattaccaatgaagaaatactcgagctggacgtagacatacttgtcccagca
gccgtcgaaaacgtcataacaaaggacaatgcacccagaataaaagccaaaatcataagc
gaaggcgcaaatggtccaacaacccccgaggcagacgagatactaaggaagaaagacgca
atcgtaatcccagatatccttgcaaacgctggaggcgtagtcatgtcctggatagagtgg
gcaaacaacaggatgggcaactggctcactgaggaagaggcgctttcaaggctagaaaag
aaaatggtcgagaacttcggtagcgtctacaacgagtggcagaaaagattccacgagtat
ccaatgagaattgcggcatatgcgatcgcagtagaaagagtagtaacggcaatgaagctc
aggggctggatctaa

DBGET integrated database retrieval system