KEGG   Thermofilum sp. 1910b: N186_07510Help
Entry
N186_07510        CDS       T02802                                 

Definition
phosphofructokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
thb  Thermofilum sp. 1910b
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:thb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    N186_07510
Enzymes [BR:thb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     N186_07510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1345994..1346929)
Genome map
AA seq 311 aa AA seqDB search
MQAEKSRFDVVTLGHILLDLRFCVDAFATPDKEGAIKSQSHGVGGSAANVAIGIRRLGGK
SAVIGKVGFDDFGKNALEDLVREGVDISNVRIDALNGKTGFTLVIIDSSGQIIMYGDKGV
AETLTPEEVNTKVLRETEHLHIASLRVDTASSIAKIAKELGVRISWDPGRRQARLGLEAL
RPVIRYADIVLPNEIEAKAMTGTESIEEAAETLLKEGVGMVIIKRGARGVYVATKREVFE
VPGYRPETVVDTTGAGDAFAAGLIMGLKKFELREAVRFATIVAGLKVTRLGSHEIPTWNE
AIAVFEKQRKG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagaaaaatctagattcgacgtagtgacgcttggacacattctgcttgacctc
aggttctgtgtagacgcgtttgctactccggacaaggagggcgcaatcaagagccagagc
cacggagtcggcggtagcgcggctaatgtggctataggtatcaggaggcttggtggaaaa
agcgcagttataggcaaggttggcttcgacgactttgggaaaaacgctttggaagacctc
gtccgggagggcgtagacatttccaatgtaaggatagacgcactaaacgggaagacagga
tttaccctggtaatcatagactcaagcggacaaataatcatgtatggcgacaagggcgtt
gcagaaaccttgactcctgaagaagtgaatacaaaggttctacgagagaccgagcatctc
cacatcgctagtctacgtgtcgatacggcttcctctatagcaaagatagcgaaggagctt
ggcgtaaggatttcctgggaccccggcaggaggcaggcccgtctagggctagaagcccta
agaccagttatcaggtatgcagacatcgttctccccaacgagatagaggcaaaagccatg
acggggacagagtctatcgaggaagcagcagagaccctcttgaaagaaggagtaggaatg
gtaattatcaagagaggcgccagaggcgtatatgtggcaacaaagagagaagtgttcgag
gtcccaggctacaggcctgagacagttgttgacacgactggagcaggcgacgcattcgcc
gcaggcctaataatgggcctcaagaagtttgagctcagggaggccgtgaggtttgcaacc
attgttgcgggactcaaagttacgagactgggctcacatgagattccaacctggaacgag
gcaatagctgttttcgagaagcagagaaaaggttaa

DBGET integrated database retrieval system