KEGG   Thermofilum sp. 1910b: N186_08345Help
Entry
N186_08345        CDS       T02802                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
thb  Thermofilum sp. 1910b
Brite
Enzymes [BR:thb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     N186_08345
Transfer RNA biogenesis [BR:thb03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    N186_08345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1494836..1496281
Genome map
AA seq 481 aa AA seqDB search
MGVMQEAVKKPIKPTRMLSGVHVFAVMAKPYPCPHGKCLYCPGGPDKGTPQSYVGNEPAL
MRAIHAGFDPYLQVKLRLKQYQAMGHLPSKAEVVIMGGTFNAMPRDYQVWFVTRMFEAFN
RYPEDPPEELPSLEEAQLRNETAQIRVVGLTIETRPDWAREGDADWFLYLGATKIEIGVQ
SIHEDVLKRVNRGHGVKEVVEATRILKDAGFKVVYHIMPGLPGSNFDRDIEMVREIFSNP
DFMPDMLKIYPTLVMEGTGLYEQWRRGLYKPLTDEEAAELISEMYRYIPRWVRVIRVQRD
VPANQIIAGPKKSNLRELVERKAIEKGITINDIRYREVSRQIRRGIVPKEIRITRETYQA
SMGEEIFLAAEDPENNVLVGLIRMRIPSQYAHRWEIDGRTAIIRELHVYGPEVPIGGYDE
EAWQHKGWGSKLLKEAERIALEEYDRTKMLVLSGVGAREYYRKHGYTRPRDSPYMTKILQ
P
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgggagttatgcaggaggctgtaaagaagcccatcaagcctacaaggatgctctcaggg
gtccacgtcttcgcagtcatggctaagccctacccatgtccacatggaaaatgcctctac
tgtcccgggggaccagacaagggcacaccccaaagctatgttggcaacgagcctgcacta
atgagggcgatacatgctggcttcgacccatacctacaggtaaagctcaggctcaaacag
taccaggccatgggacatctccccagcaaggcagaggtagtaattatgggcgggaccttc
aacgccatgccccgagactaccaggtatggttcgtcacgaggatgtttgaggccttcaac
aggtaccccgaggatccacctgaagaactgccgagcctagaggaggcccagctacgaaac
gagaccgcacaaatcagggtcgtcgggctgacaatcgagaccaggccggactgggccaga
gagggggacgcagactggttcctctatctgggcgccacaaaaatagagatcggagtccag
agcatccacgaagacgtcctgaaaagggtcaaccggggccacggggtaaaagaggtcgta
gaggcgacgcgcatactgaaggacgcgggcttcaaggtcgtataccacattatgccgggt
ctgccgggatccaactttgatagggacatagagatggttagagaaatcttcagcaatcca
gacttcatgccagacatgctaaagatctacccaaccctcgtcatggagggtacaggcctc
tacgagcaatggagaagaggtctctacaagccgttgaccgacgaggaggcagcagaactc
atctccgagatgtacaggtacattccacgttgggtccgcgtaataagggttcaacgcgac
gtcccagctaaccagataatagcggggcctaaaaagtcaaacctgcgcgagctcgtcgag
agaaaagcgatagagaaggggatcacaatcaacgacattaggtacagggaggtcagccgc
cagataaggagaggtatagtccccaaggaaataaggataacaagggaaacataccaagca
agcatgggcgaagaaattttcctcgccgcagaggacccggaaaacaacgtcctcgtaggg
ctcataaggatgaggattccctcccaatacgcgcaccgctgggaaatagacggcagaacc
gcgatcataagggagctacacgtctacggcccagaggtaccaataggcgggtacgacgaa
gaggcgtggcaacacaagggctggggctccaagctcctaaaagaagccgaaagaatagcc
ttggaggaatacgacagaaccaagatgcttgtcttgtcaggtgtaggtgcgagggaatac
tatagaaaacacggctatacgagacccagggactcgccatacatgacgaagattcttcaa
ccctaa

DBGET integrated database retrieval system