KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_11140Help
Entry
TCCBUS3UF1_11140  CDS       T01866                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TCCBUS3UF1_11140
   01230 Biosynthesis of amino acids
    TCCBUS3UF1_11140
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCCBUS3UF1_11140
   00051 Fructose and mannose metabolism
    TCCBUS3UF1_11140
   00562 Inositol phosphate metabolism
    TCCBUS3UF1_11140
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TCCBUS3UF1_11140
Enzymes [BR:thc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TCCBUS3UF1_11140
Exosome [BR:thc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TCCBUS3UF1_11140
  Exosomal proteins of bladder cancer cells
   TCCBUS3UF1_11140
  Exosomal proteins of melanoma cells
   TCCBUS3UF1_11140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1089123..1089875
Genome map
AA seq 250 aa AA seqDB search
MRRVLVAGNWKMHKVPSEARVWFAELKRLLPPLQSEVAVLPAFPMLPAAKEVFFATQVAY
GAQDVSPHREGAYTGEVSARMLADLGCRYAIVGHSERRRYHGETDALVAEKAKRLLEEGL
TPILCVGEPLEVRERGEAVPYTLAQLRGSLEGVEPKAPEGLVVAYEPVWAIGTGKNATPE
DAEAMHQAIRQALGERYGEAFAQRVRILYGGSVNPKNFADLLSMPNVDGGLVGGASLELE
SFLALLKLAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgggtactggtggcaggaaactggaagatgcacaaggttccttcggaggcccgg
gtctggtttgccgagctcaaacgcctcctccctcccttgcagtccgaggtggccgtcctg
cccgccttccccatgctccccgcggccaaggaggtcttctttgctacccaggtggcctac
ggggcccaggacgtctccccccaccgggagggggcctacaccggggaggtttccgcccga
atgctggccgacctgggctgccgctacgccatcgtgggtcactcggaaaggcgccgctac
cacggggaaacggatgccctggtggcggagaaggccaagaggcttttggaggagggcctc
acccccatcctctgcgtgggggaacccctggaggtgagggagcggggggaggcggtgccc
tacaccttggcccagctccggggaagcctggaaggggtggagcccaaagcccctgagggg
ctggtggtggcctacgagcccgtctgggccatcggtacggggaaaaacgccacccccgag
gacgccgaggccatgcaccaggccatccgccaggccctgggggagcggtacggagaggcc
ttcgcccagcgggtgcgcatcctctacggggggagcgtcaaccccaagaacttcgccgac
ctcctctccatgcccaacgtggacgggggcctggtgggcggggccagcctggagctggaa
agcttcctggccttgctcaagttagcagggtaa

DBGET integrated database retrieval system