KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_12780Help
Entry
TCCBUS3UF1_12780  CDS       T01866                                 

Definition
Acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TCCBUS3UF1_12780
  Amino acid metabolism
   00300 Lysine biosynthesis
    TCCBUS3UF1_12780
Enzymes [BR:thc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TCCBUS3UF1_12780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1273103..1273918
Genome map
AA seq 271 aa AA seqDB search
MKGGLAALVGALLAVKRVLGKPKRPLRLAALADEEGMMRGVKAFLEAGLARGFRGALVAE
PEAMEVCLWQKGALRLRLLFPGRMAHGAMPYAGDNPIPKAARFVVSLKELEGKLQAAFPH
PHLGPPYLTPTRFLASAGEGQLNVIPPMAEVALDVRTVPGMDHGELLARIGELAGVGVEV
LEDRPPVETPREDPLVQAAEEALRLLGLPVRLGGVPGATDGTFLRAWAGLPVVVMGPGEK
TLPHQVDEWVDLEEVVLAARVYAALAVLYLD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggggctggccgccctggtgggggccctcttggcagtgaagcgggtcctgggg
aagcccaagcgccccctgcgcctggcggccctggcggacgaggaggggatgatgcggggg
gtgaaggccttcctcgaggccggcctggcccgaggcttccggggggccttggtggccgag
cccgaggccatggaggtctgcctctggcagaagggggccctgcgcctccgcctcctcttc
ccagggcggatggcccacggggccatgccctacgcgggggataaccccatccccaaggcg
gcccgcttcgtcgtatccctaaaggagctggaggggaaactccaggccgccttcccccac
ccccacctgggaccgccctacctcacccccacccggttcctggccagcgccggggagggg
cagctgaacgtcattccccctatggccgaggtggccctggacgtgcgcaccgtacccggg
atggaccacggggagcttttggcccggatcggggagctggcgggggtaggggtggaggtc
ctcgaggaccgcccccccgtggaaacccccagggaggaccccctggtccaggccgccgag
gaggccctcaggctccttggcctccccgtccgcctgggcggggtgcccggggccacggac
ggcaccttcctgagggcctgggccgggcttcccgtggtggtcatgggccccggggagaag
accctcccccaccaggtggacgagtgggtggacctggaggaggtggtcctggcggcccgg
gtctacgccgccttggcggtgctctacctggactga

DBGET integrated database retrieval system