KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_13070Help
Entry
TCCBUS3UF1_13070  CDS       T01866                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00360  Phenylalanine metabolism
thc00362  Benzoate degradation
thc00620  Pyruvate metabolism
thc00621  Dioxin degradation
thc00622  Xylene degradation
thc00650  Butanoate metabolism
thc01100  Metabolic pathways
thc01120  Microbial metabolism in diverse environments
thc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TCCBUS3UF1_13070
   00650 Butanoate metabolism
    TCCBUS3UF1_13070
  Amino acid metabolism
   00360 Phenylalanine metabolism
    TCCBUS3UF1_13070
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TCCBUS3UF1_13070
   00622 Xylene degradation
    TCCBUS3UF1_13070
   00621 Dioxin degradation
    TCCBUS3UF1_13070
Enzymes [BR:thc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TCCBUS3UF1_13070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEV16349
UniProt: G8NDU8
Position
complement(1299648..1300553)
Genome map
AA seq 301 aa AA seqDB search
MAVLGSGNIGTDLMYKLLKHPGHMELVAVVGIDPASEGLARARALGLEASHEGIAYILER
PEIRIVFDATSAKAHVRHAKLLKEAGKIAIDLTPAARGPYVVPPVNLKAHLDKDNVNLIT
CGGQATIPLVYAVHRVAPVRYAEMVSTVASRSAGPGTRQNIDEFTFTTARGLEAIGGAGR
GKAIIILNPADPPILMTNTVRVIPEAEEVDREAIVQSIRAMEAEVQAYVPGYRLKADPVF
ERLPTPWGERTVVSMLLEVEGAGDYLPKYAGNLDIMTASARRVGEVFAQHLLGKRPEEVV
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtcctaggctccgggaacatcggcacggacctgatgtacaagctcctcaagcac
ccggggcacatggagctggtggcggtggtggggatagaccccgcctccgaggggttggcc
cgggcccgggccctgggtctagaggccagccacgaggggattgcctacatcctggaaagg
ccggagatccgcatcgtctttgacgccactagcgccaaggcccacgtgcgccacgccaag
ctcctcaaggaggcggggaagatcgccatcgacctcacccctgcggcccgggggccctac
gtggtccccccggtgaacctgaaggcccacctggacaaggacaacgtcaacctcatcacc
tgcggcggccaggccaccatccccctggtctacgcggtgcaccgggtggccccggtgcgc
tacgcggagatggtttctacggtggcctcccgttcggcggggcccggcacccggcagaac
atcgacgagttcacctttaccaccgcccggggcctggaggccatcgggggggctgggcgg
gggaaggccatcatcatcctgaatccggcggacccgcccatcctcatgaccaacaccgtg
cgggtcattcccgaggcggaggaggtggaccgggaggccatcgtgcaaagcatccgggcc
atggaggcggaggtgcaggcctacgtgcccggctaccgcctgaaggccgacccggtcttt
gagcgcctgcccaccccctggggggagcggacggtggtttccatgctcctagaggtggaa
ggagcgggggactacctgcccaagtacgcggggaatctggacatcatgaccgcctcggcc
cggagggtgggggaggtcttcgcccagcaccttttgggcaagcggcccgaggaggtggtg
gcgtga

DBGET integrated database retrieval system