KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_13720Help
Entry
TCCBUS3UF1_13720  CDS       T01866                                 

Definition
Magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:thc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1364350..1365744
Genome map
AA seq 464 aa AA seqDB search
MKAKTLGELRRTYPLERLRRTVKEEARENLREKLRRGERLFPGIHGYEDTVIPALVQAIL
AKQNFILLGTRGQAKSRILRSLVSLLDEAIPALPTELRDNPLSPISPEGKRLLEEAGDEA
PIVWVEREERYVEKLATPDTTVADLLGDMDPIKAARRGTGMADLESIHFGLLPRANRGIF
AVNELADLAPKVQVALFNILEEGDVQIRGYPIRLPLDVWLVFTANPQDYTARGRIVTPLK
DRIGSEIRTHYPRSLEEGLRISAQEAYVPQGVLVPEWVRLSVEAVAFAAREDRRVDQTAG
VSQRLAISLLELVAASAERRALLQGLRPVARPLDLYAGLPAITGKLELEYEGELQGAERV
AKEVVQRAFGLVLPRYRLRTEPIVAHFEAGNLLTLPEAGPQEALEAMAEVPGLLEAARTL
AGSEEAELLLSAGEFILEGLVGRRKLSRGEASYQAADRSRSYGN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggccaagaccctaggcgagctgcgccgtacctaccccctggaaaggctacggcgc
acggtgaaggaggaggcccgggagaacctccgggagaagctccgccggggggagcggctt
ttccccggcatccacggttacgaggacacggtgatccccgccttggtccaggccatcctg
gccaagcagaacttcatcctcctgggtacccggggccaggccaaaagccggatcctgcgc
agcctggtcagcctcctggacgaagccatccccgccctgcccacggagctgcgcgacaac
cccctttcccccatctcccctgaggggaagcggcttttggaggaggcaggggacgaggcc
cccatcgtctgggtggagcgggaggagcggtacgtggagaagctggccacccccgacacc
accgtggccgacctcctgggggacatggaccccatcaaggcggcccggcggggcacgggc
atggcggacctggagagcatccactttggcctcctgccgcgggccaaccgggggatcttc
gccgtgaacgagctggccgacctggcccccaaggtccaggtggccctgttcaacatcctc
gaggaaggcgatgtccagatccgcggctaccccatcaggctgcccctggacgtctggctg
gtcttcaccgccaacccccaggactacaccgcccggggccggatcgtgacccccctgaag
gaccgcatcggcagcgagatccgcacccactacccgaggagcctggaagagggcttgcgc
atcagcgcccaggaggcctacgtgccccaaggggtcctggtgcccgagtgggtgcggctt
tccgtggaggcggtggccttcgccgcccgggaggaccgccgggtggaccagaccgccggg
gtttcccagcgcctggccatcagcctcctggagctggtggcggcctcggcggaaaggcgg
gcccttctccagggcctccgccccgtggcccggcccctggacctctacgccggcctcccc
gccatcaccggcaagctggagctggagtacgagggggagctgcagggggcggagcgggtg
gccaaggaggtggtgcaacgggccttcggcctggtcctcccccgctaccgcctgaggacc
gagcccatcgtggcccactttgaggcgggcaacctcctcaccctgcccgaggcgggcccc
caagaagccctggaggccatggccgaggtgccggggctcctggaggccgcccgcaccctg
gcggggagcgaggaggccgagctcctcctttcggcgggggagttcatcctggaaggcctg
gtggggcggcgcaaactctcccggggggaggccagctaccaggccgcggaccggagccgg
agctacggcaactag

DBGET integrated database retrieval system