KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_14620Help
Entry
TCCBUS3UF1_14620  CDS       T01866                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:thc00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:thc00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1451170..1451925
Genome map
AA seq 251 aa AA seqDB search
MGNLAGKTVLVTGAGSGIGLAMARAFAREGARVLVHDVRDASRVAEELGGVFLQADLADP
EAVAALGQKAAELGAGILVNNAGFQHIDPVEAFPLEVWQRMLQVMLTAPFQLIRALLPGM
KARGWGRILNIASVHGLVASPYKSAYIAAKHGLLGLTKTVALEAGPFGVTVNAIAPAYVR
TPLVENQVQDQARTLGLPPEEVAAKVFLAQAAIPRLIEPEEVAELALFLASEKASAITGA
VFPIDLGWTAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacctggcaggaaagacggtcctcgtcacgggtgcgggaagcggcatcggcctg
gccatggcccgggccttcgcccgggaaggggccagggtcctggtccacgacgtgagggac
gcctcgagggtggcggaggaactgggaggggttttcctccaagccgacctcgcggacccg
gaggcggtggccgccctgggccagaaggccgcggagctgggggcggggatcctggtcaac
aacgccggtttccagcacattgacccggtggaggccttccccctggaggtctggcaaagg
atgctccaggtgatgctcaccgcccccttccagctcatccgggccctcctgccggggatg
aaggccaggggctgggggcggatcctcaacatcgccagcgtccacggcctggtggccagc
ccctacaagagcgcctacatcgctgccaagcacggcctcttgggcctgaccaagaccgtg
gccctcgaggccggccccttcggcgtcaccgtaaacgccatcgcccccgcctacgtgcgc
acccccctggtggaaaaccaggtccaggaccaggcccgcaccctgggcctccccccggag
gaggtggcggccaaggtcttcctggcccaggcagccatcccccgcctcattgagcccgag
gaggtggccgagctggccctcttcctggcctcggaaaaggccagcgccatcaccggggcg
gtcttccccattgacctgggctggacggcccgctaa

DBGET integrated database retrieval system