KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_14620Help
Entry
TCCBUS3UF1_14620  CDS       T01866                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    TCCBUS3UF1_14620
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    TCCBUS3UF1_14620
Enzymes [BR:thc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     TCCBUS3UF1_14620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1451170..1451925
Genome map
AA seq 251 aa AA seqDB search
MGNLAGKTVLVTGAGSGIGLAMARAFAREGARVLVHDVRDASRVAEELGGVFLQADLADP
EAVAALGQKAAELGAGILVNNAGFQHIDPVEAFPLEVWQRMLQVMLTAPFQLIRALLPGM
KARGWGRILNIASVHGLVASPYKSAYIAAKHGLLGLTKTVALEAGPFGVTVNAIAPAYVR
TPLVENQVQDQARTLGLPPEEVAAKVFLAQAAIPRLIEPEEVAELALFLASEKASAITGA
VFPIDLGWTAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacctggcaggaaagacggtcctcgtcacgggtgcgggaagcggcatcggcctg
gccatggcccgggccttcgcccgggaaggggccagggtcctggtccacgacgtgagggac
gcctcgagggtggcggaggaactgggaggggttttcctccaagccgacctcgcggacccg
gaggcggtggccgccctgggccagaaggccgcggagctgggggcggggatcctggtcaac
aacgccggtttccagcacattgacccggtggaggccttccccctggaggtctggcaaagg
atgctccaggtgatgctcaccgcccccttccagctcatccgggccctcctgccggggatg
aaggccaggggctgggggcggatcctcaacatcgccagcgtccacggcctggtggccagc
ccctacaagagcgcctacatcgctgccaagcacggcctcttgggcctgaccaagaccgtg
gccctcgaggccggccccttcggcgtcaccgtaaacgccatcgcccccgcctacgtgcgc
acccccctggtggaaaaccaggtccaggaccaggcccgcaccctgggcctccccccggag
gaggtggcggccaaggtcttcctggcccaggcagccatcccccgcctcattgagcccgag
gaggtggccgagctggccctcttcctggcctcggaaaaggccagcgccatcaccggggcg
gtcttccccattgacctgggctggacggcccgctaa

DBGET integrated database retrieval system