KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_15030Help
Entry
TCCBUS3UF1_15030  CDS       T01866                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:thc01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:thc00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1497732..1498970)
Genome map
AA seq 412 aa AA seqDB search
MIYRAEEVRERFARRGLSFDPKVEEVVRGILEAVRAEGDAALDRFSLDLDGHPVEEIPKR
AWRQAYEDLDEALRDALETAKERIEAFYREEAKGGFLKADAAGVLGQLVRPLARVGVYVP
GGSAPLLSSLLMSVIPAKVAGVGEVIVASPPRVHPGVLAAAWVAGADRLFAMGGAQAIAA
LAYGTARVPRVDKIVGPGNAYVVAAKRQVYGVVGLDGLAGPTETMLVADGSASPKLLAAD
LLAQAEHGPDSEPWLLSPDRALLERVEAELYRQLQDLPRAEMARKALERGGLVLTQDLEE
ALALANLYAPEHLCLALADPLPWLGKVQNAGGVFLGEGSPEALGDYIAGPSHVMPTSGTA
RFQGGLAVRDFLKVIPVIGLGEKAVRELSAKGAVLARAEGLEGHARSLDLRQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccgcgcggaggaggtgagggagcgcttcgcccggcgggggctctcttttgac
cccaaggtggaggaggtggtgcggggcatcctcgaggcggtgcgggcggaaggggatgcc
gccttggaccgcttcagcctggacctggacggccaccccgtggaggagatccccaagcgc
gcctggcgccaggcctacgaggacctggacgaggccctgcgggatgccctggaaaccgcc
aaggagcgcattgaggccttctaccgcgaggaggccaagggcggcttcctgaaggcggat
gcggccggggtcctgggccagctggtgcggcccctggcccgggtaggggtctacgtgccc
gggggaagcgccccccttctttccagcctcctcatgagcgtgattcccgccaaggtggcc
ggggtgggggaggtgatcgtggccagcccccctagggtccaccccggggtgctggccgcg
gcctgggtggcgggggcggaccggcttttcgccatgggcggggcccaggccatcgccgcc
ctggcctacggcaccgcccgcgtgccccgggtggacaagatcgtgggccccgggaacgcc
tacgtggtggcggccaagcgccaggtctacggggtggtgggcctggacggcctggcgggt
cccacggagaccatgctggtggccgatggttccgcctcgcccaagctccttgccgccgac
ctcctggcccaggcggagcacgggcccgactccgagccctggctcctctccccggatagg
gccctcctagagcgggtggaggcggagctctaccgccagcttcaggacctcccccgggcg
gagatggcccggaaggccctggagcggggggggctggttctcacccaggacctggaggag
gccttggccctggccaacctctacgcccccgagcacctctgcctggccctcgccgaccct
ttgccttggcttggcaaggtgcaaaacgccggcggggtcttcctgggggagggaagccct
gaggccctgggggactacatcgccggccccagccacgtgatgcctacctcgggcacggcc
cgcttccaggggggcttggccgtgcgggactttctcaaggtgatcccggtgatcggcctg
ggggagaaggcggtgcgggagctttccgccaagggggcggttctggcccgggccgagggc
ctggaggggcatgcccgttccctggacctaaggcaatga

DBGET integrated database retrieval system