KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_15410Help
Entry
TCCBUS3UF1_15410  CDS       T01866                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TCCBUS3UF1_15410
Enzymes [BR:thc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TCCBUS3UF1_15410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1537886..1538977
Genome map
AA seq 363 aa AA seqDB search
MILGSTGSIGRQALEVCRWRGYRVVGLAAGRNLEALSQQIAEWRPERVAADEALHGELKA
RFPWLRLASAEEVAALEAEVAVAAIPGLAGLSPTRVAAQTGKRIALANKEAMVAAGPLLW
QEVERGKAEVLPVDSEHSALFQALLGERREDVAELILTASGGPFLREPQDLSQVTPEMAL
AHPRWRMGPKVTVDSATLFNKGLEVLEAKELFRFPLERVRVLVHPQAYVHGLVRFVDGSL
KAQLGPTDMRLPIQYALSYPERGETPLRDLPIPGVLEFLEPDPKRFPALEVAYEAGRRGG
VAQAAVSAADEVAVEAFLQGQLPFPRIAEVLAKVLERTPDLPLTWENLFAVDAWAREEAK
RWA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctcggttccacgggttccattggccggcaggccctggaggtctgccgttggcgg
ggttaccgggtggtgggcctggcggcagggcggaacctggaagccctttcccagcagatc
gccgagtggcggcccgaacgggtggcggcggacgaagccctccacggcgagctcaaggcc
cgctttccctggctccgcctggcctccgccgaggaggtggccgccctggaggccgaggtg
gccgtggccgccatcccgggcctggccggcctctcccccacccgggtggcggcccagacg
ggaaaacgcatcgccctggccaacaaggaggccatggtggccgcaggcccccttctgtgg
caggaggtggaaaggggcaaggcggaggtcctccccgtggactcggagcactccgccctt
ttccaggcccttctgggcgaaaggcgggaggatgtggccgaactcatcctcaccgccagc
ggcgggcccttcctgcgggaaccccaggacctctcccaggtcaccccggagatggccctg
gcccacccccgttggaggatggggcccaaggtcaccgtggactccgccaccctcttcaac
aagggcctcgaggtcctggaggccaaggaactcttccgcttccccttggaaagggtccgg
gtgctggtccacccccaggcctacgtgcacggcctggtgcgtttcgtggacgggagcctc
aaggcccagctcgggcccacggacatgcgcctacccatccagtacgccctctcctacccc
gagcggggggaaacccccttgcgggacctgcccataccgggggtgttggagttcctggag
ccggaccccaagcgcttccccgccctggaggtggcctacgaggccggccggcggggcggg
gtggcccaggcggcggtctccgccgcggatgaggtggcggtggaggccttcctccagggc
cagttgcccttcccccgcatcgcggaagtgttggccaaggtcctggaaaggaccccggac
cttcccctaacatgggagaacctcttcgccgtggacgcatgggcccgggaggaggccaag
aggtgggcatga

DBGET integrated database retrieval system