KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_15660Help
Entry
TCCBUS3UF1_15660  CDS       T01866                                 

Definition
Protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TCCBUS3UF1_15660
Enzymes [BR:thc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TCCBUS3UF1_15660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1559101..1560465
Genome map
AA seq 454 aa AA seqDB search
MAQVAVVGGGWAGLAAALALEEAGADFLLLEASPRLGGKVFTHRKDGFLVEGGPDASVRY
KREVLELAGRFGLEPLGTLPAKPAAYILRRGRAHPLPEGLLQVVPGDFLGLVRTPLLSLG
GKLRALYDLLLPRGRKEDESLRAFVERRLGLEVYEALVAPLAGGIYGGEPDELSMRAAFP
QLLALEEKHRSLLLGAMRARRARPSREGGSLFFSFREGLGALTARMAAQVAEKTLLATPV
LGVEPLGGRYRLHTPRGTLEAEALILATPAPVAGGLLRPFLPQATALLKGIPHIPAATAS
LAFREELPVEGHGLLMAKGEGYRVRGFTWTHRKWPGRAPEGFSLVRAYFSGEVARLSEAE
LVRVALEDLRRHLGQEVRPERTFAFRFPEGMPAYRVGHRERIRGLEMALLQAPGVFLAGN
YLEGVGLPEVVRSGQRAAERALGYLALAPKAERL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaggtagccgtggtgggcgggggctgggcggggctggccgccgccttggccctc
gaggaggccggggccgacttcctcctcctggaagcctccccccgcctagggggcaaggtc
ttcacccaccgcaaggacgggttcttggtggagggggggccggacgccagcgtgcgctac
aagcgggaggtcctggagctggccgggcgcttcggcctggagcccctaggcaccctgccc
gccaagcccgcggcctacatcctgcgccggggcagggctcacccccttcccgaggggctc
ttgcaggtggtgccgggggacttcctgggcctcgtccgcacccccttgctctcccttggg
ggaaagctccgggccctttacgacctcctccttccccgggggaggaaggaggacgaaagc
ctaagggcgtttgtggaaaggcggctgggcctcgaggtctacgaggccctggtcgccccc
ctggcgggggggatctacggcggggaaccggacgagctctccatgagggccgccttcccc
cagctcctggccctagaagagaagcaccgcagcctcctcctgggggccatgcgcgcgcgg
cgggcccgcccaagccgcgaggggggcagcctcttcttctccttccgcgagggcctgggc
gccctcaccgccaggatggccgcccaggtggcggaaaagaccctcctcgccaccccggtc
ctgggggtggagcccctgggggggcgctaccgcctccacacccctaggggcaccctggag
gccgaggccctcatcctggccaccccggccccggtggccgggggcctcctccggcccttc
ctcccccaggccaccgccctcctcaaggggatcccccacatccccgcggccacggccagc
ctggccttccgggaggagctcccggtggaggggcacggcctcctcatggccaagggggaa
gggtaccgggtgcggggcttcacctggacccaccggaagtggccgggaagggcccccgag
gggttcagcctggtgcgggcctacttctccggggaggtggcccggctttccgaggccgag
ctggtgcgggtggccctggaggacctccgccgccacctgggccaggaggtgcgccccgag
cgcaccttcgccttccgcttccccgaggggatgcccgcctaccgggtgggccaccgggag
cggatcagggggctggagatggccctcctccaggccccgggggtctttttggccgggaac
tacctggaaggggtgggcctgcccgaagtggtgcgctcggggcaaagggcggcggaaagg
gccctgggctacctggccctggcccccaaggccgaaaggctctag

DBGET integrated database retrieval system