KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_15660Help
Entry
TCCBUS3UF1_15660  CDS       T01866                                 

Definition
(GenBank) Protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00860  Porphyrin and chlorophyll metabolism
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TCCBUS3UF1_15660
Enzymes [BR:thc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TCCBUS3UF1_15660
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     TCCBUS3UF1_15660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_oxidored FAD_binding_2 Pyr_redox_2 Pyr_redox_3 HI0933_like GIDA FAD_binding_3 Pyr_redox Lycopene_cycl AlaDh_PNT_C Thi4
Motif
Other DBs
NCBI-ProteinID: AEV16607
UniProt: G8N8V0
Position
1559101..1560465
Genome map
AA seq 454 aa AA seqDB search
MAQVAVVGGGWAGLAAALALEEAGADFLLLEASPRLGGKVFTHRKDGFLVEGGPDASVRY
KREVLELAGRFGLEPLGTLPAKPAAYILRRGRAHPLPEGLLQVVPGDFLGLVRTPLLSLG
GKLRALYDLLLPRGRKEDESLRAFVERRLGLEVYEALVAPLAGGIYGGEPDELSMRAAFP
QLLALEEKHRSLLLGAMRARRARPSREGGSLFFSFREGLGALTARMAAQVAEKTLLATPV
LGVEPLGGRYRLHTPRGTLEAEALILATPAPVAGGLLRPFLPQATALLKGIPHIPAATAS
LAFREELPVEGHGLLMAKGEGYRVRGFTWTHRKWPGRAPEGFSLVRAYFSGEVARLSEAE
LVRVALEDLRRHLGQEVRPERTFAFRFPEGMPAYRVGHRERIRGLEMALLQAPGVFLAGN
YLEGVGLPEVVRSGQRAAERALGYLALAPKAERL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaggtagccgtggtgggcgggggctgggcggggctggccgccgccttggccctc
gaggaggccggggccgacttcctcctcctggaagcctccccccgcctagggggcaaggtc
ttcacccaccgcaaggacgggttcttggtggagggggggccggacgccagcgtgcgctac
aagcgggaggtcctggagctggccgggcgcttcggcctggagcccctaggcaccctgccc
gccaagcccgcggcctacatcctgcgccggggcagggctcacccccttcccgaggggctc
ttgcaggtggtgccgggggacttcctgggcctcgtccgcacccccttgctctcccttggg
ggaaagctccgggccctttacgacctcctccttccccgggggaggaaggaggacgaaagc
ctaagggcgtttgtggaaaggcggctgggcctcgaggtctacgaggccctggtcgccccc
ctggcgggggggatctacggcggggaaccggacgagctctccatgagggccgccttcccc
cagctcctggccctagaagagaagcaccgcagcctcctcctgggggccatgcgcgcgcgg
cgggcccgcccaagccgcgaggggggcagcctcttcttctccttccgcgagggcctgggc
gccctcaccgccaggatggccgcccaggtggcggaaaagaccctcctcgccaccccggtc
ctgggggtggagcccctgggggggcgctaccgcctccacacccctaggggcaccctggag
gccgaggccctcatcctggccaccccggccccggtggccgggggcctcctccggcccttc
ctcccccaggccaccgccctcctcaaggggatcccccacatccccgcggccacggccagc
ctggccttccgggaggagctcccggtggaggggcacggcctcctcatggccaagggggaa
gggtaccgggtgcggggcttcacctggacccaccggaagtggccgggaagggcccccgag
gggttcagcctggtgcgggcctacttctccggggaggtggcccggctttccgaggccgag
ctggtgcgggtggccctggaggacctccgccgccacctgggccaggaggtgcgccccgag
cgcaccttcgccttccgcttccccgaggggatgcccgcctaccgggtgggccaccgggag
cggatcagggggctggagatggccctcctccaggccccgggggtctttttggccgggaac
tacctggaaggggtgggcctgcccgaagtggtgcgctcggggcaaagggcggcggaaagg
gccctgggctacctggccctggcccccaaggccgaaaggctctag

DBGET integrated database retrieval system