KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_15900Help
Entry
TCCBUS3UF1_15900  CDS       T01866                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00260  Glycine, serine and threonine metabolism
thc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01130  Biosynthesis of antibiotics
thc01230  Biosynthesis of amino acids
Module
thc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TCCBUS3UF1_15900
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TCCBUS3UF1_15900
Enzymes [BR:thc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TCCBUS3UF1_15900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth UPF0149
Motif
Other DBs
NCBI-ProteinID: AEV16631
UniProt: G8N8X4
Position
complement(1587499..1588278)
Genome map
AA seq 259 aa AA seqDB search
MTTQEAFARAKAQGRAALIPYLTAGFPSREGFLRAVEEVLPYADLLEIGLPYSDPLGDGP
VIQRASEVALKKGMSVQGVLELFREVRSLTDKPLFLMTYLNPILAWGPERFFSLFRQAGA
TGLILPDLPPDEDPALVRLAQEIGLETVFLLAPTSTDRRIETVVAYATGFVYAVSVTGVT
GERERLPEEVGDLVRRIRAKTPLPVAVGFGVSGRSTAAQAAVADGVVVGSALVRALEGDR
PLAPLLEEVLEGLCRREPA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcaggaagcctttgcccgggccaaggcccaaggccgggccgccctcatcccc
tacctcaccgccggcttccccagccgggagggcttcctaagggccgtggaggaggtcctc
ccctacgccgacctcctggagatcggcctgccctactccgaccccttgggggacggcccc
gtgatccagcgggccagcgaggtggccctgaagaaggggatgagcgtccagggggttttg
gagctctttcgggaggtgcgttccctcaccgataagcccctcttcctcatgacctacctg
aaccccatcctggcctggggaccggagcgcttctttagccttttccgccaggccggggcc
acgggcctcatcctccccgacctgccccccgacgaagacccggccctggtgcgcctggcc
caggagatcggcctggaaaccgtcttcctcctcgcccccacctccaccgaccgccgcatt
gagaccgtggtggcctacgccacgggcttcgtctacgcggtctccgtcaccggggtcacg
ggggaacgggagcgcctgcccgaggaggtgggggacctggtgcggcgcatccgggccaag
acccccctgcctgtggccgtgggcttcggggtttctggccgctccacggcggcccaggcg
gcggtggcggacggggtggtggtgggaagcgccctggtgcgggccctggaaggggatcgc
cccctggcccctctcctggaggaggttcttgaaggcctttgccggagggagcccgcctag

DBGET integrated database retrieval system