KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_15910Help
Entry
TCCBUS3UF1_15910  CDS       T01866                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00260  Glycine, serine and threonine metabolism
thc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01130  Biosynthesis of antibiotics
thc01230  Biosynthesis of amino acids
Module
thc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TCCBUS3UF1_15910
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TCCBUS3UF1_15910
Enzymes [BR:thc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TCCBUS3UF1_15910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF3708
Motif
Other DBs
NCBI-ProteinID: AEV16632
UniProt: G8N8X5
Position
complement(1588275..1589498)
Genome map
AA seq 407 aa AA seqDB search
MEMLTLPDFPLPDARGRFGPYGGRYVPETLIPALEEVEAAYLEARQDPRFLAELDHYLKH
FAGRPTPLFHARRLSEYWGGAQVYLKREDLLHTGAHKINNTLGQALLAKRMGKGRVVAET
GAGQHGVSVATVAALFGLECVVYMGEEDVRRQALNVFRMKLLGAEVRPVASGSRTLKDAT
NEAIRDWITHVRSTFYILGSVVGPHPYPRMVRDFQSVIGEEVKEESLRRFGRYPDALIAA
VGGGSNAIGLFAPFAYLPKGERPRLIGVEAAGEGLASGRHAASIGAGKRGVLHGSYMYLL
YDHDGQITPAHSVSAGLDYPGVGPEHSYYADAGLAEYASVTDEEALEGFKLLARLEGILP
ALESAHAIAHAAKVVPEMDKDQIVVINLSGRGDKDVTEVMGLLGGEL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggagatgctaaccttgccggattttcccctgccggatgccagggggcggtttggcccc
tacggggggcggtacgtccccgaaaccctgatcccggccctggaggaggtggaagccgcc
tacctcgaggccaggcaggatcctcgctttttggcggagctggaccattacctgaagcac
ttcgctggccgtcccaccccgctttttcacgcccggcggctttccgagtactggggtggg
gcccaggtgtacctgaagcgggaagacctcctgcacaccggggcccataagatcaacaac
accctgggccaggccctcctggccaagcgcatgggcaaggggcgggtggtggcggaaacg
ggggcgggccagcacggggtgagcgtggccacggtggcggccctctttggcctggagtgc
gtggtctacatgggggaggaggacgtgcggcgccaggccctcaacgtcttccgcatgaag
ctcctgggggccgaggtacggcccgtggcctcgggtagccgcaccctcaaggacgccacc
aacgaggccatccgcgactggatcacccacgtgcgctccaccttctacatcctgggctcg
gtggtgggcccccacccctaccccaggatggtgcgggacttccaaagcgtcatcggcgag
gaggtgaaggaggaaagcctcaggcgctttggccgctaccccgatgccctcatcgccgcc
gtgggcggcgggtccaacgccatcggcctctttgcccctttcgcctacctgcccaaaggg
gaaaggccccgcctcatcggggtggaggccgcaggggaagggcttgccagcggccggcac
gcggccagcatcggcgccgggaagcggggggtgttgcacgggagctacatgtaccttctc
tacgaccacgacggccagatcaccccggcccactccgtttccgctgggttggactacccg
ggggtggggccggagcacagctactacgccgacgccggcctggccgagtacgccagcgtc
accgacgaggaggccctggagggcttcaagctcctggcccgcctcgagggcatcctgccc
gccctggagtccgcccacgccatcgcccatgccgccaaggtggtgccggagatggacaag
gaccagatcgtggtcatcaacctctcgggccggggggataaggacgtgaccgaggtgatg
ggccttctcgggggggagctatga

DBGET integrated database retrieval system