KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_16260Help
Entry
TCCBUS3UF1_16260  CDS       T01866                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TCCBUS3UF1_16260
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TCCBUS3UF1_16260
Enzymes [BR:thc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TCCBUS3UF1_16260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1624444..1625352
Genome map
AA seq 302 aa AA seqDB search
MRHLLDFGGWTRQEVESLLDTAKVMAEVLQRPVKKVPALQGFTVATVFFEPSTRTRLSFE
LAARRMSADVVSFTAQTSSLQKGESYKDTLLTLEAMGVDAYVIRADAAGVPHQATRWVKG
VVVNGGDGRRAHPTQALLDAYTLLEALGSLEGKKIAIVGDILHSRVARSNAELLPLLGAE
VWCAGPPSLLPQALPGARLTPSLEEALAEADAVMVLRLQRERMEAGLVNLQDYIAHYQVT
EARLRRAKPQAPLLHPGPMNRDVELEGTLADSERSLVARQVQNGVAVRMAVLYHLLVGKE
RA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacctcttggacttcgggggatggacgcggcaggaggtggaaagcctcctggac
acggccaaggtgatggccgaggtgctccagcgcccggtgaagaaggtgcccgccctccag
ggcttcaccgtagccacggtcttctttgagccctccacccgcacccgcctctcctttgag
ctggcggcccggcggatgtccgcggacgtggtctccttcaccgcccagaccagcagcctg
caaaagggggaaagctacaaggataccctgctgaccctcgaggccatgggggtggacgcc
tacgtgatccgggccgacgccgccggggtgccccaccaggccacccgctgggtgaagggg
gtggtggtgaacgggggggatgggcgccgggcccaccccacccaggccctcctggacgcc
tacaccttgctggaggccctggggagcttggagggcaaaaagatcgccatcgtgggggat
atcctccactcccgggtggcccgctccaacgccgaactcctccccctcctgggggcggag
gtctggtgcgccggcccccccagcctcctgccccaggccctgcccggggcgcggcttacc
cccagcctggaagaggccctggccgaggcggacgccgtgatggtgctcaggctgcaaagg
gagcggatggaagccggcctggtgaacctccaggactacatcgcccactaccaggtcacc
gaggcccgcctgcgccgggccaagccccaagcccccctcctccacccgggccccatgaac
cgggacgtggagctggagggcaccctggcggactcggaaaggagcctggtggcgcggcag
gtacaaaacggcgtggccgtgcgcatggccgtgctctatcacctcttggtgggaaaggag
cgggcatga

DBGET integrated database retrieval system