KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_1650Help
Entry
TCCBUS3UF1_1650   CDS       T01866                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TCCBUS3UF1_1650
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCCBUS3UF1_1650
  Lipid metabolism
   00071 Fatty acid degradation
    TCCBUS3UF1_1650
  Amino acid metabolism
   00350 Tyrosine metabolism
    TCCBUS3UF1_1650
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TCCBUS3UF1_1650
   00626 Naphthalene degradation
    TCCBUS3UF1_1650
Enzymes [BR:thc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TCCBUS3UF1_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
180597..181607
Genome map
AA seq 336 aa AA seqDB search
MGQAGNNRAMRAMVLRRVGEPLALEDLSLPRPGPGEVLLKVEACGVCRTDQHIADGELPP
PRLPLVLGHQVVGRVAALGEGVEGIPLGARRGVGWLGGTCGACKFCRRGQENLCPQAEFT
GYGRDGGYAEYTLARAAFTYPLPEGLPAEGLAPWLCAGLIGYRAYRMVRDREVLGLYGFG
AAAHLLLQVARHEGKRVYAFVRPGDEAAKAFARELGAVWAGDSTEDPPEPLEGALIFAPV
GELVPKALADTEPGGVVVLGGIHMSPIPSMPYRLLWGERTLRSVANLTREDARAFLEVAP
KVPVRAEVEVFPLEEANRALEALRGGGLRGAAVLVP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgggccaggcagggaacaatagggccatgcgggccatggtgttgcggagggtaggggag
cccctggccctggaggatctctccctcccccgcccgggtccgggggaggttctcctgaag
gtggaggcctgcggggtctgccgcacggaccagcacatcgccgatggggagcttcccccg
cccaggttgcccttggtcctggggcaccaggtggtggggcgggtggctgccctgggggag
ggggtggagggcatccccttgggggcccggcggggggtggggtggctggggggaacctgt
ggggcctgcaagttctgccgccgaggccaggagaacctctgtccgcaggcggagttcacc
ggctacgggcgggacggggggtatgcggagtacaccctggcccgggcggccttcacctac
cccttgcccgaagggcttcccgcggagggcctggccccttggctttgtgccgggctcatc
ggctaccgggcctaccggatggtgcgggaccgggaggtccttggcctttacggcttcggg
gccgcggcccacctccttctccaggtggcgcgccatgaggggaagcgggtctacgccttt
gtccgcccaggggacgaggcggccaaggcctttgcccgagagctaggggcggtctgggcg
ggggactccacggaagaccccccggagcccctggaaggggccctcatctttgcccccgtg
ggggagctggtgcccaaggccttggcggacacggagccaggaggggtggtggtcctgggg
gggatccacatgagccccatcccctccatgccctaccgcctcctctggggggagcggacc
ctccgttccgtggccaacctcacccgggaggatgcccgggccttcctggaggtagccccg
aaggttccggtgcgggcggaggtggaggtcttccccctggaggaggccaaccgggccctc
gaggccctccggggaggcgggcttagaggggcagcggtgctggtgccttag

DBGET integrated database retrieval system