KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_1650Help
Entry
TCCBUS3UF1_1650   CDS       T01866                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00010  Glycolysis / Gluconeogenesis
thc00071  Fatty acid degradation
thc00350  Tyrosine metabolism
thc00625  Chloroalkane and chloroalkene degradation
thc00626  Naphthalene degradation
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01120  Microbial metabolism in diverse environments
thc01130  Biosynthesis of antibiotics
thc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCCBUS3UF1_1650
  Lipid metabolism
   00071 Fatty acid degradation
    TCCBUS3UF1_1650
  Amino acid metabolism
   00350 Tyrosine metabolism
    TCCBUS3UF1_1650
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TCCBUS3UF1_1650
   00626 Naphthalene degradation
    TCCBUS3UF1_1650
Enzymes [BR:thc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TCCBUS3UF1_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AEV15214
UniProt: G8N7U6
Position
180597..181607
Genome map
AA seq 336 aa AA seqDB search
MGQAGNNRAMRAMVLRRVGEPLALEDLSLPRPGPGEVLLKVEACGVCRTDQHIADGELPP
PRLPLVLGHQVVGRVAALGEGVEGIPLGARRGVGWLGGTCGACKFCRRGQENLCPQAEFT
GYGRDGGYAEYTLARAAFTYPLPEGLPAEGLAPWLCAGLIGYRAYRMVRDREVLGLYGFG
AAAHLLLQVARHEGKRVYAFVRPGDEAAKAFARELGAVWAGDSTEDPPEPLEGALIFAPV
GELVPKALADTEPGGVVVLGGIHMSPIPSMPYRLLWGERTLRSVANLTREDARAFLEVAP
KVPVRAEVEVFPLEEANRALEALRGGGLRGAAVLVP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgggccaggcagggaacaatagggccatgcgggccatggtgttgcggagggtaggggag
cccctggccctggaggatctctccctcccccgcccgggtccgggggaggttctcctgaag
gtggaggcctgcggggtctgccgcacggaccagcacatcgccgatggggagcttcccccg
cccaggttgcccttggtcctggggcaccaggtggtggggcgggtggctgccctgggggag
ggggtggagggcatccccttgggggcccggcggggggtggggtggctggggggaacctgt
ggggcctgcaagttctgccgccgaggccaggagaacctctgtccgcaggcggagttcacc
ggctacgggcgggacggggggtatgcggagtacaccctggcccgggcggccttcacctac
cccttgcccgaagggcttcccgcggagggcctggccccttggctttgtgccgggctcatc
ggctaccgggcctaccggatggtgcgggaccgggaggtccttggcctttacggcttcggg
gccgcggcccacctccttctccaggtggcgcgccatgaggggaagcgggtctacgccttt
gtccgcccaggggacgaggcggccaaggcctttgcccgagagctaggggcggtctgggcg
ggggactccacggaagaccccccggagcccctggaaggggccctcatctttgcccccgtg
ggggagctggtgcccaaggccttggcggacacggagccaggaggggtggtggtcctgggg
gggatccacatgagccccatcccctccatgccctaccgcctcctctggggggagcggacc
ctccgttccgtggccaacctcacccgggaggatgcccgggccttcctggaggtagccccg
aaggttccggtgcgggcggaggtggaggtcttccccctggaggaggccaaccgggccctc
gaggccctccggggaggcgggcttagaggggcagcggtgctggtgccttag

DBGET integrated database retrieval system