KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_16550Help
Entry
TCCBUS3UF1_16550  CDS       T01866                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TCCBUS3UF1_16550
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TCCBUS3UF1_16550
Enzymes [BR:thc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     TCCBUS3UF1_16550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1654565..1656010
Genome map
AA seq 481 aa AA seqDB search
MTLEELFAPFGLPAPPLEVRGLALDSRRVEPGFVFVAAPGVPLPHRKPLDGHDFIPEALA
RGAIAVVGERDLTLPVPYLRVADSRLALAQLARRFYGEPDRRLALLGVTASKGKSTTASL
LHHLLQGAGVGTALLSTVGLRLGEEARPPVGHFTTPEAPEVYGFLREAADRGLSAAVLEV
SSHALALKRVEGLGYRIGVFVSFYPDDHLDLHGTPEAYFAAKALLVARAEVAVLHTGLPH
LEGLRSRPHLLVGPGGEVWAQGVREEEGGVGFRLHTPWGQGEVFLPLLGTYNVDNALAAA
AAALLYGVPLEGVLQGLATFPGVPGRMEVVQGQPFRVVIDFAHTGKSLEAALSTLRRTTR
GRLLLVVGAAGERDPRRREDIGRVAARLADLTFFTEEDHRGEPLEAILQALAQAAEREGG
RYALVPDRREAIFRALREARPGDTVLLAGKGHERTLERGGEALPWDEKAVAQEALASLGL
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaccctagaggaactcttcgccccctttggcctcccggcccccccgctggaggtgcgg
gggctggccctggactcgaggcgggtggagcccggcttcgtcttcgtggccgcccccggg
gtcccccttccccaccgcaagcccctggacgggcacgatttcatccccgaggccctggcc
cggggggccatcgccgtggtgggggaaagggacctcaccctccccgtcccctacctgagg
gtggcggatagccgcctggccctggcccagctggcccggcggttttacggggaacccgac
cggaggctagccctcctgggggttacggcctccaaggggaagagcaccacggcgagcctc
ctccaccacctcctgcaaggggccggggtgggtacggccctcctctccaccgtgggcctg
cggctgggggaggaagcccgcccgcccgtgggccacttcaccacccccgaggcccccgag
gtctacggcttcctgcgggaggccgcggatcggggactttccgcggcggtcttggaggtt
tccagccatgccctggccctgaagcgggtggagggtctgggctaccgcatcggggtcttc
gtgagcttctaccccgacgaccacctggacctgcacggcacccctgaggcctactttgcc
gccaaggccctcctggtggcccgggcggaggtggccgtgctgcacacagggctaccccac
ctagaagggctgcggtcccggccccatctcctggtggggcccgggggggaggtatgggcc
caaggggtgcgggaggaggaggggggggtggggttccggctccacaccccctggggccag
ggggaggtcttcctgcccctcctcgggacctacaacgtggacaacgccctggccgccgcc
gccgccgccctcctctacggggttcccctggagggggttctccagggcctggccaccttc
cccggggttccggggaggatggaggtggtacaagggcaacctttccgcgtggtcattgac
ttcgcccacaccgggaagagcctcgaggccgccctttccaccctgcgccgcaccacccgg
ggccgcctcctcctggtggtgggggcggcgggggagcgggacccaaggcggcgggaggac
attggccgggtggcggcccgcctggccgacctcaccttcttcaccgaggaggaccaccgc
ggggagcccttggaggccatcctgcaggccctggcccaggccgcggaacgggaaggcggg
cgctacgccctggtccccgaccgccgggaggccatcttccgggccctgcgggaagcccgc
cccggggacaccgtcctcctggcgggcaaggggcacgaacgcaccctggaacggggcggg
gaagccctcccctgggacgagaaggccgtggcccaggaagccctagcctccttgggcctc
ggctag

DBGET integrated database retrieval system