KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_16700Help
Entry
TCCBUS3UF1_16700  CDS       T01866                                 

Definition
Succinate dehydrogenase, membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TCCBUS3UF1_16700
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TCCBUS3UF1_16700
   00650 Butanoate metabolism
    TCCBUS3UF1_16700
  Energy metabolism
   00190 Oxidative phosphorylation
    TCCBUS3UF1_16700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1671052..1671447)
Genome map
AA seq 131 aa AA seqDB search
MAIKSKRYAEARLEANTNLELYWWVFMRISGVVLVFLLIGHMWMNAILMDLNKIDYDYVA
QRLSQTTWKIYDWLILALALLHGANGLRYVLDDWVRDPAKRFWTKVVAYGLIGFLFLLGS
LSLFNHDFGVK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaagtccaagcggtatgctgaggccaggctcgaggccaacaccaacctggag
ctttactggtgggtcttcatgcgcatctccggggtggtcttggtcttcttgctcatcggc
cacatgtggatgaacgccatcctcatggacctcaacaagattgactacgactacgtggcc
cagagactttcccagaccacctggaagatctacgactggctcatcctggccctggccctc
ctgcacggggccaacgggctccgctacgttctggacgactgggtgcgggacccggccaag
cgcttctggaccaaggtggtggcctacggcctcatcggcttcctcttcctcttgggcagc
ctttcccttttcaaccatgattttggggtgaagtag

DBGET integrated database retrieval system