KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_19060Help
Entry
TCCBUS3UF1_19060  CDS       T01866                                 

Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:thc00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    TCCBUS3UF1_19060
Enzymes [BR:thc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     TCCBUS3UF1_19060
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     TCCBUS3UF1_19060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1911280..1912074
Genome map
AA seq 264 aa AA seqDB search
MPELPEVETTRRRLLPLLRGRRLLGVQHEDPTRYRHTERAEGREVEALDRRGKFLLLALS
GGLEMVIHLGMTGGFRLEKTPHTRVRFRLEGGELFFHDPRRFGRIWVVDRGDYREIPLLG
RLGPEPLSEGFAFPPFWEGLRRSRKPLKALLLDQTLAAGVGNIYADEALFRAGLSPFRWG
RSLKEEEAKRLFQSLRQVLAEAVALGGSTLSDRTYQQPDGLPGGYQERHAVYGRQGLPCP
RCGHPLAKAVVGGRGTHFCPACQT
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagctccccgaggtggagaccacccggcggaggctcctccccctcctccggggc
cggcgccttcttggggtccagcacgaagaccccacccgctaccgccacacggagcgggcc
gagggccgggaggtggaggcgttggaccgccgggggaagttcctcctcctcgccctctcg
gggggcctggagatggtgatccacctgggcatgaccgggggcttccgcctggagaagacc
cctcacacccgggtgcgcttccgcctggaaggaggggagctcttcttccacgacccccgg
cgcttcgggcggatttgggtggtggaccggggggactaccgcgagatcccccttctgggg
cgccttggccccgagcccctttccgaggggttcgccttcccccccttctgggaaggcctg
aggcggagccgaaagcccctcaaggccctcctcttggaccagaccctggccgcgggggtg
ggaaacatctacgccgacgaggccctcttccgcgcgggcctctcccccttccgctgggga
aggtccctgaaggaggaggaggccaagcggcttttccaaagcctccgccaggtcctggcc
gaggccgtggccctaggggggagcaccctctccgaccgcacctaccagcagcccgatggc
ctcccgggaggctaccaggagcggcacgcggtctatggccgccaggggcttccctgcccc
cggtgcggccaccccctggccaaggcggtggtggggggccggggcacccacttctgcccc
gcctgccagacctag

DBGET integrated database retrieval system