KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_19110Help
Entry
TCCBUS3UF1_19110  CDS       T01866                                 

Definition
Fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:thc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1915744..1916322)
Genome map
AA seq 192 aa AA seqDB search
MLARLYTAFRQVGEDLFGQGLISATAGNFSVRGKEGFLITKSGVQKARLTPEDLVEVPLE
GPFPPGASVESVIHREVYRRTQAQALVHAHPRVAVALSLHLDRLLPLDLEGQYYLREVPV
LAPKTTSASEEAASAVAEALAHHRVCLLRGHGAFAAGFKERPEEALLEAYSLMTTLEESA
EILLYHRLWGGG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccggctttacaccgcctttcgccaggtgggggaggaccttttcgggcaaggc
ctcatctccgccaccgcgggtaacttctccgtgcggggcaaggagggcttcctcatcacc
aaaagcggggtgcaaaaggcccgcctgacccccgaggacctggtggaggtgcccctggag
ggcccctttccccccggggccagcgtggagagcgtgatccaccgggaggtttaccggcgc
acccaggcccaggccctggtccacgcccacccccgggtggccgtggccctctcccttcac
ctggaccgcctcctgcccctggacctcgagggccagtactacctgcgggaggtgcccgtt
ctggcccctaagaccacctcggccagcgaggaggctgcctccgccgtggccgaggccctg
gcccaccaccgggtctgcctccttcggggccacggggccttcgccgccggtttcaaggaa
aggcccgaggaggcccttctggaggcctatagcctcatgaccaccctggaggagagcgcg
gaaatcctcctgtaccatcggctttgggggggaggatga

DBGET integrated database retrieval system