KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_19630Help
Entry
TCCBUS3UF1_19630  CDS       T01866                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TCCBUS3UF1_19630
Enzymes [BR:thc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     TCCBUS3UF1_19630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1969104..1969583)
Genome map
AA seq 159 aa AA seqDB search
MLAYVALGGNLGDRAAYLLQALSRLSRLPETQLLRLSPVYETDPVGPPQPPYLNLVAELE
TRLPPRALLEALLGIEQALGRVRREPWGPRTVDLDLLLYGDRVLKEEGLEVPHPRLHQRA
FVLVPLCDLVPQGRHPVLGRTFAELLAALDPSGVRPLVL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgttggcgtacgtggccttgggcggcaacctgggggaccgggccgcctacctccttcag
gccctttcccgcctctcccgcctgccggaaacccagctcctgcggctttcccccgtgtac
gagacggaccccgtgggcccgccccagcccccctacctgaacctggtggcggagctggag
acccgcctccccccccgggccctcctggaggccctcctgggcatagagcaggccctgggg
cgggtgcggcgggagccctggggtccccgtaccgtggacctggacctcctcctttacggg
gaccgggtcctaaaggaagagggcttggaggtgccccacccccggctccaccagcgggcc
tttgtcctggtgcccctttgcgacctggttccccagggccgtcacccggtgttggggagg
acctttgccgagctcctggccgctttggacccctcgggggtccgtccccttgtgctatag

DBGET integrated database retrieval system